Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0VBN2

Protein Details
Accession A0A0L0VBN2   
Localization Confidence Low
Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
86-105NSQKRKMKGMPSKSDRLNKGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 13.833, cyto 5, cyto_pero 3.499
Family & Domain DBs
InterPro View protein in InterPro  
IPR000727  T_SNARE_dom  
PROSITE View protein in PROSITE  
PS50192  T_SNARE  
Amino Acid Sequences MHMKEKAEREEVRQQYKSRERTENNFKPKGAPNELRSRLADAACYRFENAEPDDDLENKLNENVDEISGSISRLTLVSGTMGTEINSQKRKMKGMPSKSDRLNKGFQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.6
3 0.67
4 0.68
5 0.65
6 0.67
7 0.64
8 0.68
9 0.76
10 0.75
11 0.75
12 0.72
13 0.65
14 0.61
15 0.63
16 0.61
17 0.58
18 0.55
19 0.51
20 0.57
21 0.6
22 0.57
23 0.5
24 0.46
25 0.4
26 0.33
27 0.31
28 0.22
29 0.22
30 0.21
31 0.2
32 0.17
33 0.15
34 0.16
35 0.15
36 0.14
37 0.13
38 0.12
39 0.13
40 0.13
41 0.13
42 0.14
43 0.12
44 0.11
45 0.1
46 0.1
47 0.08
48 0.08
49 0.09
50 0.08
51 0.07
52 0.07
53 0.07
54 0.08
55 0.07
56 0.08
57 0.06
58 0.06
59 0.06
60 0.06
61 0.06
62 0.05
63 0.05
64 0.05
65 0.05
66 0.06
67 0.06
68 0.06
69 0.07
70 0.11
71 0.14
72 0.21
73 0.25
74 0.27
75 0.33
76 0.37
77 0.42
78 0.43
79 0.51
80 0.55
81 0.6
82 0.69
83 0.7
84 0.74
85 0.77
86 0.8
87 0.76
88 0.72