Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0VDV7

Protein Details
Accession A0A0L0VDV7   
Localization Confidence High
Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
4-45VDNKAKLEKDQKGAKRKPQYISGSIKTAKQRKIDRVRAEDKMHydrophilic
303-325QSKIDPLKQRALKCRQERQEEALHydrophilic
NLS Segment(s)
PositionSequence
15-20KGAKRK
Subcellular Location(s) nucl 22.5, cyto_nucl 14, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018612  NSRP1_N  
Gene Ontology GO:0000381  P:regulation of alternative mRNA splicing, via spliceosome  
Pfam View protein in Pfam  
PF09745  NSRP1_N  
Amino Acid Sequences MELVDNKAKLEKDQKGAKRKPQYISGSIKTAKQRKIDRVRAEDKMVHANKDEFVTPAYLEEQKELREAEQIEKLKAKQAPNKQAMSNFYQNTLEQDLKRNKATVKAVAAVAGASTSKKTPSGGISLGLSTTLSNVENQAVNPSQTSQLQSPQYNPEPEAVPSEAKLATKIGKKLGRNVDLDDEGRIVDHRQLLTGGLNLGPPKALGPHQQQQTKKKIGFALPISERRAQEQRDKEEAKSQNNLGEHDHDHDEGLSQAEKIELSRERQLLLLQQQLIDLDHKKRKAEEDSELENLKKVVKRNDQSKIDPLKQRALKCRQERQEEALTKDVQIQASSST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.68
3 0.77
4 0.8
5 0.82
6 0.82
7 0.79
8 0.78
9 0.77
10 0.75
11 0.75
12 0.69
13 0.66
14 0.6
15 0.6
16 0.6
17 0.61
18 0.59
19 0.59
20 0.63
21 0.66
22 0.75
23 0.79
24 0.79
25 0.8
26 0.8
27 0.76
28 0.73
29 0.66
30 0.58
31 0.59
32 0.52
33 0.45
34 0.41
35 0.38
36 0.34
37 0.32
38 0.29
39 0.2
40 0.18
41 0.17
42 0.14
43 0.14
44 0.15
45 0.16
46 0.16
47 0.18
48 0.19
49 0.18
50 0.21
51 0.2
52 0.18
53 0.19
54 0.21
55 0.21
56 0.28
57 0.29
58 0.29
59 0.32
60 0.32
61 0.34
62 0.37
63 0.41
64 0.42
65 0.49
66 0.57
67 0.6
68 0.63
69 0.59
70 0.58
71 0.55
72 0.53
73 0.51
74 0.41
75 0.36
76 0.34
77 0.32
78 0.3
79 0.3
80 0.27
81 0.21
82 0.29
83 0.34
84 0.36
85 0.38
86 0.38
87 0.35
88 0.38
89 0.41
90 0.37
91 0.33
92 0.31
93 0.29
94 0.27
95 0.25
96 0.18
97 0.14
98 0.09
99 0.07
100 0.05
101 0.06
102 0.06
103 0.07
104 0.08
105 0.09
106 0.1
107 0.12
108 0.16
109 0.15
110 0.16
111 0.15
112 0.15
113 0.14
114 0.12
115 0.1
116 0.06
117 0.06
118 0.06
119 0.05
120 0.06
121 0.06
122 0.08
123 0.08
124 0.08
125 0.11
126 0.11
127 0.11
128 0.11
129 0.11
130 0.11
131 0.12
132 0.14
133 0.12
134 0.17
135 0.2
136 0.21
137 0.22
138 0.26
139 0.28
140 0.27
141 0.26
142 0.22
143 0.2
144 0.19
145 0.2
146 0.16
147 0.13
148 0.12
149 0.13
150 0.12
151 0.11
152 0.11
153 0.09
154 0.12
155 0.15
156 0.17
157 0.22
158 0.26
159 0.27
160 0.34
161 0.4
162 0.4
163 0.38
164 0.38
165 0.35
166 0.32
167 0.31
168 0.24
169 0.17
170 0.12
171 0.11
172 0.09
173 0.07
174 0.08
175 0.1
176 0.09
177 0.09
178 0.1
179 0.1
180 0.1
181 0.1
182 0.08
183 0.06
184 0.07
185 0.07
186 0.07
187 0.06
188 0.06
189 0.06
190 0.07
191 0.08
192 0.14
193 0.2
194 0.27
195 0.34
196 0.4
197 0.46
198 0.53
199 0.59
200 0.61
201 0.56
202 0.52
203 0.5
204 0.48
205 0.48
206 0.42
207 0.4
208 0.38
209 0.41
210 0.41
211 0.41
212 0.38
213 0.37
214 0.4
215 0.37
216 0.41
217 0.44
218 0.47
219 0.51
220 0.53
221 0.5
222 0.53
223 0.56
224 0.51
225 0.48
226 0.43
227 0.38
228 0.37
229 0.37
230 0.3
231 0.28
232 0.25
233 0.24
234 0.25
235 0.2
236 0.19
237 0.18
238 0.16
239 0.13
240 0.13
241 0.1
242 0.08
243 0.08
244 0.08
245 0.08
246 0.07
247 0.12
248 0.14
249 0.17
250 0.24
251 0.24
252 0.25
253 0.25
254 0.26
255 0.27
256 0.28
257 0.3
258 0.24
259 0.23
260 0.23
261 0.23
262 0.23
263 0.2
264 0.2
265 0.24
266 0.3
267 0.33
268 0.36
269 0.39
270 0.44
271 0.49
272 0.5
273 0.5
274 0.5
275 0.51
276 0.53
277 0.53
278 0.46
279 0.39
280 0.34
281 0.32
282 0.28
283 0.3
284 0.35
285 0.43
286 0.51
287 0.59
288 0.69
289 0.7
290 0.72
291 0.75
292 0.75
293 0.73
294 0.72
295 0.68
296 0.68
297 0.67
298 0.7
299 0.7
300 0.71
301 0.73
302 0.75
303 0.8
304 0.8
305 0.83
306 0.81
307 0.77
308 0.78
309 0.73
310 0.69
311 0.64
312 0.56
313 0.47
314 0.47
315 0.44
316 0.34
317 0.29