Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0V2L6

Protein Details
Accession A0A0L0V2L6    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
9-30IPSIPTARKTTKRKSDKAAGSHHydrophilic
NLS Segment(s)
PositionSequence
48-53KKARKP
Subcellular Location(s) nucl 16.5, cyto_nucl 10, mito 7
Family & Domain DBs
Amino Acid Sequences MPSITNPNIPSIPTARKTTKRKSDKAAGSHQPSELEIGEDEPATQPAKKARKPATKLSKAAVTPKPDDHTTEKDETASVNVDDIKKTTGSRSGNYITEEDVQICLSWLETTEDPLNSTNQSGTTFWDRVHGHYMEHLPHYPRSADSVKSRLEALRRAGQGQGEGLQSYAMLPYPFDGPKMARLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.44
3 0.53
4 0.61
5 0.68
6 0.73
7 0.76
8 0.79
9 0.81
10 0.83
11 0.81
12 0.8
13 0.79
14 0.77
15 0.73
16 0.68
17 0.6
18 0.51
19 0.43
20 0.37
21 0.28
22 0.2
23 0.13
24 0.12
25 0.11
26 0.1
27 0.1
28 0.09
29 0.1
30 0.1
31 0.1
32 0.12
33 0.19
34 0.29
35 0.32
36 0.4
37 0.49
38 0.58
39 0.63
40 0.71
41 0.74
42 0.73
43 0.72
44 0.66
45 0.61
46 0.53
47 0.55
48 0.49
49 0.43
50 0.38
51 0.38
52 0.39
53 0.34
54 0.37
55 0.34
56 0.34
57 0.34
58 0.33
59 0.31
60 0.27
61 0.27
62 0.23
63 0.19
64 0.15
65 0.1
66 0.08
67 0.09
68 0.09
69 0.09
70 0.1
71 0.1
72 0.09
73 0.1
74 0.1
75 0.15
76 0.16
77 0.17
78 0.21
79 0.22
80 0.22
81 0.23
82 0.23
83 0.18
84 0.17
85 0.16
86 0.12
87 0.1
88 0.09
89 0.08
90 0.07
91 0.06
92 0.05
93 0.04
94 0.05
95 0.07
96 0.07
97 0.09
98 0.11
99 0.11
100 0.12
101 0.13
102 0.13
103 0.11
104 0.12
105 0.1
106 0.09
107 0.11
108 0.1
109 0.12
110 0.16
111 0.17
112 0.16
113 0.23
114 0.22
115 0.23
116 0.28
117 0.25
118 0.21
119 0.24
120 0.26
121 0.22
122 0.24
123 0.25
124 0.22
125 0.23
126 0.25
127 0.22
128 0.2
129 0.24
130 0.24
131 0.26
132 0.29
133 0.32
134 0.32
135 0.32
136 0.34
137 0.31
138 0.33
139 0.33
140 0.34
141 0.36
142 0.36
143 0.36
144 0.36
145 0.34
146 0.31
147 0.27
148 0.24
149 0.17
150 0.16
151 0.14
152 0.12
153 0.11
154 0.1
155 0.09
156 0.08
157 0.07
158 0.07
159 0.08
160 0.13
161 0.13
162 0.14
163 0.16
164 0.17