Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C6HLU4

Protein Details
Accession C6HLU4    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
190-249MPSLGRSPKGKKDKGKKKVQAQKPQVQKAQTQKAQARKEQRQARRKHKQAVRKANNQSNPHydrophilic
NLS Segment(s)
PositionSequence
194-242GRSPKGKKDKGKKKVQAQKPQVQKAQTQKAQARKEQRQARRKHKQAVRK
Subcellular Location(s) nucl 16, cyto_nucl 13.333, cyto 9.5, mito_nucl 8.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR011082  Exosome-assoc_fac/DNA_repair  
IPR007146  Sas10/Utp3/C1D  
Gene Ontology GO:0005634  C:nucleus  
GO:0003723  F:RNA binding  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF04000  Sas10_Utp3  
Amino Acid Sequences METTDLTPLIEQLEDNIDDLEDVLEPLLGQPLSATTQKMPVMDKAKLHVLITYAIESLIFSYLRLQGVNAKEHPVFKELTRVKQYFEKIKTVETVPEKRTTAVDKEAAGRFIKHGLAGNDKYDLERAERDAKEKAMALLKAAKLARQQASKSQPQPKTQSITHKEQQAPTEVDSELGNTGSKGGQHLKVMPSLGRSPKGKKDKGKKKVQAQKPQVQKAQTQKAQARKEQRQARRKHKQAVRKANNQSNP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.13
4 0.11
5 0.11
6 0.11
7 0.1
8 0.06
9 0.06
10 0.05
11 0.05
12 0.05
13 0.05
14 0.08
15 0.07
16 0.07
17 0.07
18 0.09
19 0.12
20 0.13
21 0.15
22 0.13
23 0.18
24 0.2
25 0.22
26 0.22
27 0.26
28 0.3
29 0.32
30 0.32
31 0.3
32 0.34
33 0.34
34 0.32
35 0.26
36 0.22
37 0.2
38 0.2
39 0.18
40 0.13
41 0.11
42 0.1
43 0.09
44 0.09
45 0.08
46 0.07
47 0.06
48 0.08
49 0.11
50 0.11
51 0.12
52 0.11
53 0.16
54 0.19
55 0.23
56 0.22
57 0.24
58 0.25
59 0.27
60 0.28
61 0.24
62 0.22
63 0.18
64 0.27
65 0.27
66 0.33
67 0.39
68 0.38
69 0.38
70 0.43
71 0.47
72 0.46
73 0.46
74 0.44
75 0.37
76 0.38
77 0.38
78 0.32
79 0.34
80 0.31
81 0.34
82 0.31
83 0.34
84 0.33
85 0.32
86 0.33
87 0.3
88 0.26
89 0.24
90 0.23
91 0.2
92 0.23
93 0.23
94 0.24
95 0.21
96 0.18
97 0.15
98 0.15
99 0.14
100 0.11
101 0.12
102 0.12
103 0.17
104 0.18
105 0.18
106 0.17
107 0.17
108 0.17
109 0.15
110 0.14
111 0.1
112 0.1
113 0.12
114 0.18
115 0.18
116 0.2
117 0.21
118 0.21
119 0.2
120 0.2
121 0.19
122 0.15
123 0.15
124 0.14
125 0.16
126 0.16
127 0.19
128 0.19
129 0.19
130 0.17
131 0.22
132 0.25
133 0.25
134 0.26
135 0.3
136 0.36
137 0.41
138 0.47
139 0.51
140 0.52
141 0.55
142 0.6
143 0.57
144 0.56
145 0.53
146 0.56
147 0.53
148 0.55
149 0.53
150 0.55
151 0.53
152 0.51
153 0.49
154 0.44
155 0.39
156 0.33
157 0.31
158 0.23
159 0.2
160 0.17
161 0.16
162 0.11
163 0.1
164 0.08
165 0.06
166 0.07
167 0.07
168 0.07
169 0.09
170 0.13
171 0.15
172 0.17
173 0.21
174 0.21
175 0.23
176 0.24
177 0.22
178 0.22
179 0.25
180 0.28
181 0.3
182 0.33
183 0.37
184 0.46
185 0.55
186 0.6
187 0.64
188 0.71
189 0.76
190 0.82
191 0.88
192 0.87
193 0.87
194 0.9
195 0.9
196 0.9
197 0.89
198 0.87
199 0.86
200 0.86
201 0.81
202 0.73
203 0.7
204 0.69
205 0.7
206 0.66
207 0.64
208 0.63
209 0.66
210 0.7
211 0.72
212 0.72
213 0.71
214 0.77
215 0.78
216 0.81
217 0.82
218 0.85
219 0.88
220 0.88
221 0.88
222 0.89
223 0.88
224 0.88
225 0.89
226 0.9
227 0.89
228 0.88
229 0.89