Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C6HKI5

Protein Details
Accession C6HKI5   
Localization Confidence Low
Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
57-78GITKKSKSKQITRAQRKRQEKGHydrophilic
NLS Segment(s)
PositionSequence
60-107KKSKSKQITRAQRKRQEKGLERAELIMDRTEKKMAKSMGKAKVVKERR
Subcellular Location(s) mito 17, nucl 5.5, cyto_nucl 5.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR022784  Ribosome_bgen_Alb1  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF09135  Alb1  
Amino Acid Sequences MAKTAKVKAKVSSKSMHSRAAKRAVSPTNESLLKFVPRTEPIPTVKPHILSAQHNAGITKKSKSKQITRAQRKRQEKGLERAELIMDRTEKKMAKSMGKAKVVKERRVRIFLPFPVLFYYLVVNKTNGHPVHVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.62
3 0.64
4 0.62
5 0.62
6 0.64
7 0.67
8 0.61
9 0.54
10 0.58
11 0.55
12 0.53
13 0.52
14 0.46
15 0.43
16 0.42
17 0.4
18 0.33
19 0.3
20 0.28
21 0.23
22 0.22
23 0.21
24 0.22
25 0.24
26 0.25
27 0.28
28 0.28
29 0.32
30 0.32
31 0.33
32 0.32
33 0.31
34 0.29
35 0.27
36 0.28
37 0.25
38 0.28
39 0.26
40 0.25
41 0.24
42 0.23
43 0.21
44 0.2
45 0.2
46 0.19
47 0.22
48 0.22
49 0.29
50 0.35
51 0.42
52 0.49
53 0.57
54 0.65
55 0.7
56 0.79
57 0.81
58 0.85
59 0.85
60 0.79
61 0.77
62 0.76
63 0.72
64 0.7
65 0.67
66 0.6
67 0.52
68 0.48
69 0.41
70 0.32
71 0.25
72 0.19
73 0.14
74 0.13
75 0.14
76 0.18
77 0.19
78 0.19
79 0.25
80 0.27
81 0.31
82 0.38
83 0.45
84 0.49
85 0.55
86 0.56
87 0.53
88 0.59
89 0.61
90 0.62
91 0.62
92 0.63
93 0.63
94 0.66
95 0.64
96 0.61
97 0.61
98 0.55
99 0.54
100 0.45
101 0.39
102 0.36
103 0.36
104 0.29
105 0.22
106 0.22
107 0.17
108 0.2
109 0.2
110 0.19
111 0.2
112 0.22
113 0.3
114 0.27