Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0V2X6

Protein Details
Accession A0A0L0V2X6   
Localization Confidence Medium
Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
181-207NEEHENDKDRKRKKNEKKTENKAAKAABasic
NLS Segment(s)
PositionSequence
188-214KDRKRKKNEKKTENKAAKAAEQHEKQK
Subcellular Location(s) nucl 23, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002999  Tudor  
IPR043560  ZGPAT  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
GO:0045892  P:negative regulation of DNA-templated transcription  
PROSITE View protein in PROSITE  
PS50304  TUDOR  
Amino Acid Sequences MDAKELETYEYQLSQVNLVLEKDPTNAECLSLQGELVNLITLTKDFLAQTAPSKQTNSSGDHKESSLDNSSNKLSSRNRSKTPHDQQQQDKSAKPSTLQSDTSLSKSLNPGDLCMAKYAGDGKYYPAKITTIGGSSDTRIYTVVFKGYDTTDLVSATEIRPITDHNSNKKRNLDSSATNNNEEHENDKDRKRKKNEKKTENKAAKAAEQHEKQKSWQSFAKKSVKKGVHIPGIVGDSMFASPDNPFGKVGVVGSGKGMTQYGGKQRHKFNGNGLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.16
4 0.16
5 0.16
6 0.17
7 0.16
8 0.16
9 0.17
10 0.17
11 0.16
12 0.17
13 0.16
14 0.16
15 0.15
16 0.15
17 0.15
18 0.13
19 0.13
20 0.1
21 0.1
22 0.09
23 0.08
24 0.08
25 0.05
26 0.05
27 0.06
28 0.05
29 0.07
30 0.06
31 0.08
32 0.07
33 0.08
34 0.1
35 0.11
36 0.16
37 0.21
38 0.24
39 0.25
40 0.27
41 0.27
42 0.31
43 0.33
44 0.34
45 0.34
46 0.37
47 0.38
48 0.38
49 0.38
50 0.33
51 0.31
52 0.3
53 0.28
54 0.24
55 0.22
56 0.23
57 0.24
58 0.25
59 0.24
60 0.27
61 0.27
62 0.34
63 0.44
64 0.49
65 0.54
66 0.59
67 0.66
68 0.7
69 0.74
70 0.75
71 0.72
72 0.73
73 0.74
74 0.77
75 0.77
76 0.69
77 0.63
78 0.57
79 0.53
80 0.45
81 0.39
82 0.34
83 0.31
84 0.31
85 0.29
86 0.27
87 0.27
88 0.28
89 0.28
90 0.25
91 0.2
92 0.18
93 0.19
94 0.18
95 0.19
96 0.17
97 0.16
98 0.17
99 0.19
100 0.17
101 0.16
102 0.15
103 0.1
104 0.11
105 0.13
106 0.11
107 0.1
108 0.1
109 0.11
110 0.17
111 0.17
112 0.17
113 0.15
114 0.15
115 0.15
116 0.15
117 0.14
118 0.09
119 0.09
120 0.11
121 0.1
122 0.1
123 0.11
124 0.1
125 0.09
126 0.08
127 0.09
128 0.08
129 0.09
130 0.1
131 0.09
132 0.09
133 0.1
134 0.1
135 0.11
136 0.09
137 0.1
138 0.08
139 0.08
140 0.08
141 0.07
142 0.08
143 0.07
144 0.09
145 0.09
146 0.08
147 0.08
148 0.1
149 0.13
150 0.2
151 0.25
152 0.32
153 0.42
154 0.46
155 0.51
156 0.56
157 0.55
158 0.51
159 0.52
160 0.46
161 0.42
162 0.45
163 0.49
164 0.45
165 0.44
166 0.41
167 0.36
168 0.33
169 0.29
170 0.24
171 0.2
172 0.23
173 0.26
174 0.34
175 0.41
176 0.46
177 0.56
178 0.63
179 0.7
180 0.76
181 0.82
182 0.86
183 0.89
184 0.92
185 0.92
186 0.93
187 0.9
188 0.82
189 0.76
190 0.67
191 0.6
192 0.55
193 0.5
194 0.48
195 0.45
196 0.49
197 0.5
198 0.49
199 0.48
200 0.52
201 0.49
202 0.46
203 0.46
204 0.47
205 0.48
206 0.56
207 0.64
208 0.6
209 0.63
210 0.67
211 0.66
212 0.61
213 0.62
214 0.62
215 0.59
216 0.54
217 0.49
218 0.42
219 0.39
220 0.35
221 0.27
222 0.18
223 0.11
224 0.11
225 0.1
226 0.07
227 0.06
228 0.07
229 0.13
230 0.14
231 0.14
232 0.15
233 0.15
234 0.16
235 0.16
236 0.16
237 0.16
238 0.15
239 0.14
240 0.15
241 0.15
242 0.14
243 0.14
244 0.14
245 0.09
246 0.11
247 0.17
248 0.25
249 0.35
250 0.43
251 0.5
252 0.57
253 0.66
254 0.69
255 0.66