Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0UQ38

Protein Details
Accession A0A0L0UQ38    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
28-55ASPPSTNTPKENKKKNHKKKQSAVDVEDHydrophilic
NLS Segment(s)
PositionSequence
38-47ENKKKNHKKK
Subcellular Location(s) nucl 16, cyto_nucl 11.833, cyto_mito 6.166, mito 5.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR028002  Myb_DNA-bind_5  
Pfam View protein in Pfam  
PF13873  Myb_DNA-bind_5  
Amino Acid Sequences MLELLQQAIPASNPARSSGIPDPSINLASPPSTNTPKENKKKNHKKKQSAVDVEDDVDGKRSKGNNYQENELMELCRAWVAISEDSRVGTDQEGTTFWTRIHKRYNAAIPAPTRTLKSLKSRWGNLQRDTNKFHGVCHSGEGIES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.2
3 0.19
4 0.26
5 0.28
6 0.32
7 0.31
8 0.31
9 0.31
10 0.3
11 0.31
12 0.24
13 0.19
14 0.15
15 0.14
16 0.14
17 0.14
18 0.18
19 0.21
20 0.23
21 0.28
22 0.37
23 0.46
24 0.55
25 0.62
26 0.67
27 0.74
28 0.83
29 0.89
30 0.91
31 0.92
32 0.93
33 0.92
34 0.92
35 0.91
36 0.87
37 0.78
38 0.71
39 0.6
40 0.5
41 0.41
42 0.31
43 0.21
44 0.16
45 0.13
46 0.1
47 0.12
48 0.13
49 0.16
50 0.23
51 0.31
52 0.36
53 0.38
54 0.41
55 0.39
56 0.38
57 0.36
58 0.28
59 0.2
60 0.13
61 0.1
62 0.07
63 0.05
64 0.05
65 0.04
66 0.05
67 0.07
68 0.09
69 0.1
70 0.11
71 0.11
72 0.12
73 0.12
74 0.11
75 0.09
76 0.07
77 0.08
78 0.07
79 0.08
80 0.08
81 0.11
82 0.12
83 0.12
84 0.12
85 0.2
86 0.22
87 0.26
88 0.34
89 0.35
90 0.37
91 0.44
92 0.51
93 0.47
94 0.47
95 0.47
96 0.41
97 0.41
98 0.4
99 0.35
100 0.29
101 0.27
102 0.28
103 0.29
104 0.37
105 0.4
106 0.46
107 0.53
108 0.56
109 0.64
110 0.7
111 0.71
112 0.68
113 0.72
114 0.7
115 0.68
116 0.69
117 0.63
118 0.61
119 0.54
120 0.5
121 0.47
122 0.43
123 0.38
124 0.35
125 0.33