Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0W2J4

Protein Details
Accession A0A0L0W2J4   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
68-93KATKSTKSTSGKPKTKKKSACRRQLLHydrophilic
NLS Segment(s)
PositionSequence
69-86ATKSTKSTSGKPKTKKKS
Subcellular Location(s) extr 11, mito 8, cyto 7.5, cyto_nucl 4.5
Family & Domain DBs
Amino Acid Sequences MKLLPELAKAVTEAYPVFGGFALWAAGAFDDKYELVTTVKDASSPTGWKDLGNWKSIVQFIPPKGSEKATKSTKSTSGKPKTKKKSACRRQLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.1
4 0.1
5 0.08
6 0.08
7 0.06
8 0.07
9 0.05
10 0.04
11 0.04
12 0.04
13 0.04
14 0.05
15 0.04
16 0.04
17 0.05
18 0.05
19 0.06
20 0.06
21 0.07
22 0.07
23 0.07
24 0.08
25 0.09
26 0.09
27 0.08
28 0.08
29 0.09
30 0.11
31 0.11
32 0.12
33 0.13
34 0.13
35 0.13
36 0.15
37 0.22
38 0.23
39 0.24
40 0.24
41 0.21
42 0.23
43 0.24
44 0.22
45 0.17
46 0.19
47 0.18
48 0.23
49 0.24
50 0.26
51 0.26
52 0.29
53 0.31
54 0.31
55 0.38
56 0.4
57 0.43
58 0.43
59 0.46
60 0.52
61 0.52
62 0.56
63 0.58
64 0.62
65 0.67
66 0.73
67 0.8
68 0.82
69 0.86
70 0.88
71 0.88
72 0.89
73 0.91