Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0V1S4

Protein Details
Accession A0A0L0V1S4    Localization Confidence High Confidence Score 17.1
NoLS Segment(s)
PositionSequenceProtein Nature
20-46MCGPSTMETKPKRRPRPKKLDLIEPVTHydrophilic
108-132PDDPTLKTQRKKRHRSHKVGPLEPLBasic
NLS Segment(s)
PositionSequence
29-38KPKRRPRPKK
87-89RPK
117-123RKKRHRS
Subcellular Location(s) cyto_nucl 13.5, nucl 12.5, cyto 9.5, mito 5
Family & Domain DBs
Amino Acid Sequences MVVFAAPLAAAELPISDAPMCGPSTMETKPKRRPRPKKLDLIEPVTKASIATPLVNSPIAHPPISDNPTTVPPTIVTQPTKPKIPIRPKKVGKILPPAEVMFPDTLIPDDPTLKTQRKKRHRSHKVGPLEPLTTVVPAIQTLLLPNVGLLEKPRKTSSQNLLPPLLPSSPSSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.07
4 0.07
5 0.08
6 0.1
7 0.1
8 0.09
9 0.1
10 0.1
11 0.14
12 0.17
13 0.26
14 0.31
15 0.39
16 0.5
17 0.6
18 0.69
19 0.77
20 0.85
21 0.88
22 0.91
23 0.92
24 0.92
25 0.87
26 0.86
27 0.81
28 0.77
29 0.71
30 0.61
31 0.52
32 0.42
33 0.37
34 0.26
35 0.2
36 0.15
37 0.12
38 0.11
39 0.11
40 0.11
41 0.13
42 0.14
43 0.14
44 0.13
45 0.18
46 0.18
47 0.18
48 0.17
49 0.18
50 0.23
51 0.26
52 0.24
53 0.18
54 0.18
55 0.22
56 0.23
57 0.21
58 0.15
59 0.13
60 0.15
61 0.17
62 0.19
63 0.17
64 0.19
65 0.26
66 0.28
67 0.3
68 0.31
69 0.34
70 0.39
71 0.49
72 0.54
73 0.55
74 0.62
75 0.64
76 0.68
77 0.71
78 0.67
79 0.61
80 0.62
81 0.56
82 0.49
83 0.46
84 0.39
85 0.32
86 0.27
87 0.23
88 0.13
89 0.11
90 0.08
91 0.07
92 0.07
93 0.07
94 0.08
95 0.07
96 0.09
97 0.09
98 0.12
99 0.18
100 0.24
101 0.3
102 0.37
103 0.47
104 0.56
105 0.67
106 0.74
107 0.8
108 0.84
109 0.88
110 0.9
111 0.89
112 0.88
113 0.81
114 0.75
115 0.67
116 0.57
117 0.47
118 0.39
119 0.3
120 0.2
121 0.16
122 0.12
123 0.09
124 0.08
125 0.08
126 0.06
127 0.06
128 0.06
129 0.08
130 0.07
131 0.07
132 0.07
133 0.08
134 0.07
135 0.08
136 0.12
137 0.19
138 0.22
139 0.26
140 0.3
141 0.32
142 0.36
143 0.45
144 0.51
145 0.53
146 0.57
147 0.58
148 0.58
149 0.55
150 0.52
151 0.46
152 0.38
153 0.29