Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0VKC9

Protein Details
Accession A0A0L0VKC9   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MAKSLRSKSKRAFRATKRTSATHydrophilic
NLS Segment(s)
PositionSequence
121-122RR
Subcellular Location(s) nucl 13mito 13mito_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSLRSKSKRAFRATKRTSATSDYQKTESERLLRLSKKLTGSLGEGSESATLLATQEEMQIDKGAEDQQDSTNKSAPKVSTHGPRMSGREVWKASKRGIQLRRAPSTTVWHQRSTGKPQRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.83
3 0.82
4 0.77
5 0.72
6 0.66
7 0.61
8 0.57
9 0.56
10 0.55
11 0.5
12 0.46
13 0.44
14 0.44
15 0.42
16 0.39
17 0.33
18 0.29
19 0.3
20 0.35
21 0.35
22 0.35
23 0.36
24 0.36
25 0.34
26 0.33
27 0.3
28 0.25
29 0.24
30 0.23
31 0.2
32 0.16
33 0.14
34 0.12
35 0.11
36 0.1
37 0.07
38 0.05
39 0.04
40 0.04
41 0.04
42 0.04
43 0.04
44 0.05
45 0.05
46 0.05
47 0.06
48 0.06
49 0.06
50 0.05
51 0.06
52 0.07
53 0.07
54 0.07
55 0.08
56 0.1
57 0.14
58 0.16
59 0.16
60 0.2
61 0.2
62 0.21
63 0.23
64 0.21
65 0.21
66 0.23
67 0.27
68 0.31
69 0.36
70 0.37
71 0.38
72 0.4
73 0.41
74 0.4
75 0.4
76 0.35
77 0.37
78 0.38
79 0.4
80 0.45
81 0.44
82 0.43
83 0.43
84 0.46
85 0.48
86 0.52
87 0.55
88 0.57
89 0.63
90 0.67
91 0.64
92 0.6
93 0.53
94 0.54
95 0.54
96 0.56
97 0.51
98 0.46
99 0.48
100 0.53
101 0.57
102 0.6
103 0.61