Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0VU25

Protein Details
Accession A0A0L0VU25    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MAPKKSKKRHKPPGSPTSSIAHydrophilic
NLS Segment(s)
PositionSequence
4-13KKSKKRHKPP
Subcellular Location(s) mito_nucl 12.666, nucl 12.5, mito 11.5, cyto_nucl 8.333
Family & Domain DBs
Amino Acid Sequences MAPKKSKKRHKPPGSPTSSIASTPAAPMNHSRQKKRNDTIVNIADSDEEPPAEDLDSTTPASTQTAKGRPLTDEQELKKARRVHKAEGSDCYIHYHPPQISTEAKDKNGQYMISYTCKHCGHEINRPRYDSSPSNLSKHVAGCKKDEASKNQKLTSMGISGTGDVDARDVPQLCAIWCAEGARPFSALGEQAHQGIMHPTVVQNLPTQKAVSNDIG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.84
3 0.76
4 0.7
5 0.6
6 0.49
7 0.4
8 0.31
9 0.23
10 0.22
11 0.23
12 0.18
13 0.18
14 0.23
15 0.3
16 0.38
17 0.45
18 0.51
19 0.55
20 0.65
21 0.73
22 0.75
23 0.76
24 0.74
25 0.72
26 0.73
27 0.7
28 0.62
29 0.52
30 0.45
31 0.36
32 0.29
33 0.24
34 0.15
35 0.1
36 0.09
37 0.09
38 0.09
39 0.08
40 0.08
41 0.07
42 0.08
43 0.11
44 0.1
45 0.1
46 0.09
47 0.1
48 0.11
49 0.12
50 0.14
51 0.19
52 0.23
53 0.26
54 0.28
55 0.29
56 0.3
57 0.32
58 0.33
59 0.31
60 0.33
61 0.32
62 0.38
63 0.4
64 0.4
65 0.42
66 0.45
67 0.46
68 0.49
69 0.53
70 0.51
71 0.55
72 0.61
73 0.57
74 0.54
75 0.52
76 0.42
77 0.38
78 0.34
79 0.27
80 0.21
81 0.19
82 0.2
83 0.16
84 0.18
85 0.19
86 0.18
87 0.19
88 0.21
89 0.27
90 0.24
91 0.25
92 0.27
93 0.26
94 0.26
95 0.25
96 0.22
97 0.16
98 0.16
99 0.17
100 0.17
101 0.18
102 0.16
103 0.21
104 0.21
105 0.21
106 0.22
107 0.27
108 0.27
109 0.36
110 0.45
111 0.48
112 0.51
113 0.51
114 0.51
115 0.45
116 0.47
117 0.4
118 0.34
119 0.33
120 0.33
121 0.34
122 0.33
123 0.32
124 0.28
125 0.28
126 0.32
127 0.29
128 0.29
129 0.29
130 0.32
131 0.34
132 0.38
133 0.41
134 0.42
135 0.46
136 0.52
137 0.54
138 0.52
139 0.52
140 0.47
141 0.44
142 0.38
143 0.3
144 0.21
145 0.18
146 0.16
147 0.14
148 0.13
149 0.11
150 0.08
151 0.06
152 0.07
153 0.06
154 0.06
155 0.09
156 0.1
157 0.1
158 0.12
159 0.13
160 0.12
161 0.15
162 0.14
163 0.12
164 0.11
165 0.12
166 0.13
167 0.16
168 0.18
169 0.17
170 0.18
171 0.17
172 0.17
173 0.17
174 0.16
175 0.14
176 0.14
177 0.14
178 0.14
179 0.15
180 0.14
181 0.14
182 0.13
183 0.13
184 0.11
185 0.11
186 0.1
187 0.14
188 0.16
189 0.16
190 0.19
191 0.23
192 0.25
193 0.26
194 0.27
195 0.25
196 0.27