Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0VM92

Protein Details
Accession A0A0L0VM92   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
67-97MELLRNSKDKKARKLTKRRLGTLRRAKRKVDBasic
NLS Segment(s)
PositionSequence
73-95SKDKKARKLTKRRLGTLRRAKRK
Subcellular Location(s) mito 17, nucl 5, cyto 5, cyto_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038097  L36e_sf  
IPR000509  Ribosomal_L36e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01158  Ribosomal_L36e  
PROSITE View protein in PROSITE  
PS01190  RIBOSOMAL_L36E  
Amino Acid Sequences MARAQSTRVAATRTGLPRGLNSGHKTTPRVLPNKPSHFKGRASKRTTFVRSIVREVAGFAPYERRVMELLRNSKDKKARKLTKRRLGTLRRAKRKVDELTGVIAETRRAGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.29
3 0.28
4 0.27
5 0.31
6 0.32
7 0.3
8 0.31
9 0.33
10 0.36
11 0.38
12 0.4
13 0.38
14 0.42
15 0.43
16 0.44
17 0.43
18 0.49
19 0.55
20 0.62
21 0.63
22 0.6
23 0.59
24 0.58
25 0.6
26 0.6
27 0.61
28 0.61
29 0.62
30 0.63
31 0.61
32 0.65
33 0.63
34 0.56
35 0.49
36 0.47
37 0.44
38 0.42
39 0.38
40 0.3
41 0.26
42 0.24
43 0.21
44 0.13
45 0.11
46 0.08
47 0.11
48 0.1
49 0.11
50 0.1
51 0.11
52 0.11
53 0.12
54 0.17
55 0.21
56 0.27
57 0.31
58 0.37
59 0.37
60 0.43
61 0.5
62 0.52
63 0.55
64 0.6
65 0.66
66 0.71
67 0.81
68 0.86
69 0.88
70 0.88
71 0.86
72 0.85
73 0.84
74 0.84
75 0.83
76 0.83
77 0.84
78 0.81
79 0.77
80 0.75
81 0.75
82 0.71
83 0.67
84 0.62
85 0.53
86 0.52
87 0.47
88 0.4
89 0.32
90 0.26
91 0.19