Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0V4U8

Protein Details
Accession A0A0L0V4U8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
62-84WCSAIEKKGKSKVKKKNIGALTSHydrophilic
NLS Segment(s)
PositionSequence
68-77KKGKSKVKKK
Subcellular Location(s) mito 22.5, mito_nucl 12, cyto 3
Family & Domain DBs
Amino Acid Sequences MRQIQKTSHKAFVHTSVNNERYVVNLASLASPALHREASAIVLKSVDQLAWINVLHDGLGVWCSAIEKKGKSKVKKKNIGALTSTMDPELV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.46
3 0.45
4 0.46
5 0.44
6 0.4
7 0.33
8 0.27
9 0.29
10 0.22
11 0.14
12 0.12
13 0.12
14 0.11
15 0.11
16 0.1
17 0.06
18 0.06
19 0.07
20 0.08
21 0.07
22 0.07
23 0.07
24 0.08
25 0.09
26 0.11
27 0.11
28 0.09
29 0.09
30 0.09
31 0.09
32 0.09
33 0.06
34 0.05
35 0.05
36 0.05
37 0.06
38 0.06
39 0.06
40 0.06
41 0.06
42 0.05
43 0.05
44 0.05
45 0.03
46 0.04
47 0.04
48 0.03
49 0.03
50 0.05
51 0.05
52 0.08
53 0.12
54 0.15
55 0.22
56 0.32
57 0.41
58 0.5
59 0.6
60 0.68
61 0.75
62 0.83
63 0.82
64 0.82
65 0.81
66 0.76
67 0.69
68 0.62
69 0.55
70 0.47
71 0.42