Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0W385

Protein Details
Accession A0A0L0W385    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
24-43TTMKNSRYSQNQRKNLQRLSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 13, cyto 4.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013874  Cdc37_Hsp90-bd  
IPR038189  Cdc37_Hsp90-bd_sf  
Pfam View protein in Pfam  
PF08565  CDC37_M  
Amino Acid Sequences MKKNNIEVSNPKASGADNNDELVTTMKNSRYSQNQRKNLQRLSYHPSSLLPIQADLSLYVNESTTDALLVRCFQIRKEGQKNYSQNCVHHGLLSQYCWKVGWDDVTLFLCNTPAW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.34
3 0.32
4 0.25
5 0.26
6 0.25
7 0.24
8 0.24
9 0.19
10 0.14
11 0.11
12 0.13
13 0.15
14 0.2
15 0.21
16 0.25
17 0.34
18 0.45
19 0.54
20 0.61
21 0.67
22 0.7
23 0.78
24 0.81
25 0.76
26 0.72
27 0.64
28 0.59
29 0.58
30 0.54
31 0.45
32 0.37
33 0.32
34 0.28
35 0.25
36 0.22
37 0.14
38 0.11
39 0.11
40 0.1
41 0.1
42 0.08
43 0.08
44 0.06
45 0.06
46 0.06
47 0.06
48 0.06
49 0.06
50 0.05
51 0.04
52 0.05
53 0.05
54 0.05
55 0.05
56 0.06
57 0.06
58 0.09
59 0.09
60 0.09
61 0.18
62 0.22
63 0.31
64 0.4
65 0.46
66 0.47
67 0.57
68 0.64
69 0.58
70 0.63
71 0.56
72 0.49
73 0.46
74 0.47
75 0.38
76 0.32
77 0.3
78 0.25
79 0.24
80 0.26
81 0.27
82 0.22
83 0.22
84 0.22
85 0.21
86 0.18
87 0.19
88 0.2
89 0.17
90 0.18
91 0.2
92 0.22
93 0.23
94 0.21
95 0.19