Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0V5M4

Protein Details
Accession A0A0L0V5M4   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
12-55ISLANGMRLRSKKKKNRHKQKKRKDEGKRRREEKKQHRTNLEAABasic
NLS Segment(s)
PositionSequence
19-49RLRSKKKKNRHKQKKRKDEGKRRREEKKQHR
Subcellular Location(s) mito 21, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR012337  RNaseH-like_sf  
Amino Acid Sequences MGRVYDVRGRIISLANGMRLRSKKKKNRHKQKKRKDEGKRRREEKKQHRTNLEAATRFPMGRVYDVRGRMRKRSFHVRLLQHGWRGLGQLAQQVPQLCAIWAVGSDITRLYTAVLQSFIKTLEKHSGAMYLGLDAWQSPNGYDILGTVIYRLIEDDDGHTGAYLADTVRVIVEKFGVQNKICGIVTDDTSNNATMIEEIKKFKWPLFKGETH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.24
3 0.25
4 0.24
5 0.3
6 0.34
7 0.42
8 0.47
9 0.56
10 0.61
11 0.71
12 0.82
13 0.86
14 0.92
15 0.94
16 0.95
17 0.96
18 0.97
19 0.97
20 0.97
21 0.96
22 0.96
23 0.96
24 0.96
25 0.95
26 0.95
27 0.91
28 0.9
29 0.9
30 0.9
31 0.9
32 0.9
33 0.89
34 0.87
35 0.86
36 0.8
37 0.76
38 0.74
39 0.69
40 0.6
41 0.5
42 0.44
43 0.39
44 0.34
45 0.28
46 0.23
47 0.17
48 0.19
49 0.19
50 0.21
51 0.25
52 0.31
53 0.37
54 0.41
55 0.43
56 0.48
57 0.53
58 0.54
59 0.55
60 0.61
61 0.6
62 0.61
63 0.66
64 0.61
65 0.61
66 0.61
67 0.58
68 0.49
69 0.44
70 0.36
71 0.28
72 0.25
73 0.19
74 0.14
75 0.11
76 0.13
77 0.12
78 0.12
79 0.13
80 0.13
81 0.13
82 0.12
83 0.12
84 0.08
85 0.08
86 0.07
87 0.05
88 0.05
89 0.05
90 0.04
91 0.04
92 0.05
93 0.04
94 0.05
95 0.05
96 0.05
97 0.05
98 0.06
99 0.06
100 0.06
101 0.08
102 0.08
103 0.08
104 0.08
105 0.09
106 0.09
107 0.09
108 0.11
109 0.15
110 0.16
111 0.16
112 0.16
113 0.17
114 0.15
115 0.16
116 0.14
117 0.08
118 0.07
119 0.07
120 0.06
121 0.05
122 0.05
123 0.06
124 0.06
125 0.05
126 0.07
127 0.07
128 0.07
129 0.07
130 0.06
131 0.06
132 0.07
133 0.07
134 0.06
135 0.06
136 0.06
137 0.06
138 0.07
139 0.06
140 0.06
141 0.07
142 0.08
143 0.1
144 0.1
145 0.1
146 0.1
147 0.09
148 0.08
149 0.07
150 0.06
151 0.04
152 0.05
153 0.05
154 0.06
155 0.06
156 0.07
157 0.07
158 0.07
159 0.08
160 0.08
161 0.11
162 0.16
163 0.21
164 0.2
165 0.23
166 0.23
167 0.26
168 0.25
169 0.23
170 0.22
171 0.19
172 0.21
173 0.22
174 0.22
175 0.2
176 0.21
177 0.21
178 0.17
179 0.15
180 0.13
181 0.1
182 0.13
183 0.15
184 0.17
185 0.21
186 0.22
187 0.29
188 0.31
189 0.34
190 0.41
191 0.39
192 0.45