Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0VXH8

Protein Details
Accession A0A0L0VXH8   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
8-36TEICRNRRPGSPRRTRKERRSRGTKLAAAHydrophilic
NLS Segment(s)
PositionSequence
14-31RRPGSPRRTRKERRSRGT
Subcellular Location(s) mito 21, nucl 3, cyto 2
Family & Domain DBs
Amino Acid Sequences MKLTFGGTEICRNRRPGSPRRTRKERRSRGTKLAAAQVFSTTAIPRTRIEDIDRVALQTRITDGTIGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.53
3 0.54
4 0.58
5 0.64
6 0.7
7 0.76
8 0.84
9 0.87
10 0.9
11 0.91
12 0.91
13 0.9
14 0.89
15 0.86
16 0.84
17 0.81
18 0.73
19 0.64
20 0.6
21 0.5
22 0.41
23 0.34
24 0.26
25 0.19
26 0.16
27 0.14
28 0.07
29 0.1
30 0.11
31 0.13
32 0.13
33 0.17
34 0.19
35 0.2
36 0.24
37 0.25
38 0.26
39 0.3
40 0.29
41 0.27
42 0.26
43 0.25
44 0.22
45 0.17
46 0.17
47 0.14
48 0.14