Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0UIX8

Protein Details
Accession A0A0L0UIX8    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
52-75IKPGMLRKWKQDQRKKGKEKALKEBasic
NLS Segment(s)
PositionSequence
58-75RKWKQDQRKKGKEKALKE
Subcellular Location(s) nucl 18, cyto_nucl 13.166, mito_nucl 11.666, cyto 6
Family & Domain DBs
Amino Acid Sequences KTANSNATTTTVDVERSFSFGRDYVSNRRHRLNASSVTKGMTVAFYSKNDMIKPGMLRKWKQDQRKKGKEKALKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.15
3 0.18
4 0.18
5 0.16
6 0.16
7 0.16
8 0.18
9 0.18
10 0.22
11 0.28
12 0.36
13 0.43
14 0.44
15 0.47
16 0.47
17 0.46
18 0.46
19 0.43
20 0.43
21 0.39
22 0.39
23 0.36
24 0.34
25 0.31
26 0.27
27 0.21
28 0.13
29 0.09
30 0.08
31 0.1
32 0.1
33 0.13
34 0.15
35 0.17
36 0.16
37 0.18
38 0.17
39 0.19
40 0.22
41 0.25
42 0.29
43 0.35
44 0.38
45 0.44
46 0.54
47 0.58
48 0.66
49 0.7
50 0.75
51 0.79
52 0.87
53 0.89
54 0.88
55 0.9