Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0VBP1

Protein Details
Accession A0A0L0VBP1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
82-101DECGPNKVREYQRKKRVWLTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10.5, cyto_mito 9, cysk 8, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MGQGVEESISAKFKVLACGTNTGAESYWLYPVAGVTMFQSALFAMGWDWETETKRLKVSEAKSVFLQTRKGASSGEDNISGDECGPNKVREYQRKKRVWLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.23
4 0.24
5 0.28
6 0.28
7 0.27
8 0.27
9 0.21
10 0.2
11 0.17
12 0.16
13 0.12
14 0.12
15 0.1
16 0.1
17 0.09
18 0.09
19 0.08
20 0.07
21 0.06
22 0.05
23 0.06
24 0.06
25 0.06
26 0.06
27 0.05
28 0.05
29 0.05
30 0.04
31 0.03
32 0.04
33 0.04
34 0.04
35 0.05
36 0.06
37 0.08
38 0.1
39 0.13
40 0.14
41 0.15
42 0.15
43 0.17
44 0.22
45 0.23
46 0.31
47 0.3
48 0.3
49 0.29
50 0.32
51 0.32
52 0.28
53 0.28
54 0.2
55 0.22
56 0.21
57 0.21
58 0.19
59 0.18
60 0.21
61 0.22
62 0.22
63 0.2
64 0.19
65 0.19
66 0.2
67 0.18
68 0.13
69 0.12
70 0.11
71 0.13
72 0.16
73 0.17
74 0.19
75 0.28
76 0.37
77 0.46
78 0.56
79 0.63
80 0.71
81 0.77