Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0VWK4

Protein Details
Accession A0A0L0VWK4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
202-223KGSSKSSKSKKSYDNSNYSRKIHydrophilic
NLS Segment(s)
Subcellular Location(s) golg 7, E.R. 6, extr 5, mito 3, pero 3, cyto 2, mito_nucl 2
Family & Domain DBs
Amino Acid Sequences MIRLSMIALVCFALRCTLAAPSLDVSTAPIVQAIGSLANLPFQDLQPHKPFPVDSARTLNYLKHFDPLKHFPDEKIHTEVPGGKNVELQVPRQQNSRKEFKSNIMKPPQARMKMDRTRTPTQEEEIKINNILNNYPVGHAYQLTDTPEPVILAAPIFDFEYACGKDKIYGIDGALIKETGCFHWNGPCVEECLVEAYVDCLKGSSKSSKSKKSYDNSNYSRKII
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.09
4 0.11
5 0.12
6 0.12
7 0.14
8 0.14
9 0.14
10 0.14
11 0.12
12 0.12
13 0.12
14 0.11
15 0.1
16 0.08
17 0.08
18 0.08
19 0.08
20 0.07
21 0.05
22 0.05
23 0.06
24 0.06
25 0.08
26 0.08
27 0.09
28 0.1
29 0.1
30 0.18
31 0.19
32 0.26
33 0.3
34 0.33
35 0.32
36 0.33
37 0.33
38 0.29
39 0.37
40 0.33
41 0.31
42 0.34
43 0.35
44 0.36
45 0.37
46 0.35
47 0.3
48 0.31
49 0.28
50 0.27
51 0.28
52 0.27
53 0.34
54 0.37
55 0.37
56 0.38
57 0.38
58 0.34
59 0.41
60 0.43
61 0.4
62 0.4
63 0.36
64 0.3
65 0.31
66 0.35
67 0.28
68 0.29
69 0.26
70 0.2
71 0.21
72 0.22
73 0.25
74 0.21
75 0.21
76 0.23
77 0.26
78 0.27
79 0.32
80 0.36
81 0.38
82 0.43
83 0.5
84 0.45
85 0.45
86 0.47
87 0.49
88 0.55
89 0.53
90 0.56
91 0.53
92 0.54
93 0.5
94 0.55
95 0.54
96 0.47
97 0.45
98 0.41
99 0.44
100 0.47
101 0.51
102 0.49
103 0.49
104 0.51
105 0.51
106 0.51
107 0.43
108 0.38
109 0.4
110 0.36
111 0.31
112 0.28
113 0.27
114 0.22
115 0.22
116 0.2
117 0.15
118 0.14
119 0.11
120 0.1
121 0.1
122 0.1
123 0.09
124 0.09
125 0.08
126 0.08
127 0.09
128 0.09
129 0.09
130 0.12
131 0.11
132 0.11
133 0.11
134 0.11
135 0.1
136 0.09
137 0.08
138 0.05
139 0.05
140 0.05
141 0.04
142 0.05
143 0.05
144 0.05
145 0.05
146 0.05
147 0.1
148 0.11
149 0.14
150 0.14
151 0.14
152 0.16
153 0.18
154 0.19
155 0.17
156 0.16
157 0.14
158 0.19
159 0.2
160 0.18
161 0.17
162 0.15
163 0.13
164 0.13
165 0.14
166 0.1
167 0.11
168 0.12
169 0.12
170 0.18
171 0.22
172 0.22
173 0.24
174 0.23
175 0.24
176 0.23
177 0.23
178 0.17
179 0.16
180 0.15
181 0.13
182 0.12
183 0.11
184 0.12
185 0.12
186 0.12
187 0.09
188 0.1
189 0.12
190 0.17
191 0.23
192 0.29
193 0.39
194 0.49
195 0.58
196 0.64
197 0.71
198 0.76
199 0.76
200 0.79
201 0.79
202 0.81
203 0.78
204 0.81