Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C6HA78

Protein Details
Accession C6HA78    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
49-70AERSRRAQKNRDQARENRKRIEBasic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto_nucl 15
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR013892  Cyt_c_biogenesis_Cmc1-like  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF08583  Cmc1  
PROSITE View protein in PROSITE  
PS00036  BZIP_BASIC  
Amino Acid Sequences MHSHLHTKDNINCTEIMNMLDECHARGFIHKAFAGCNEIKREVNRCLGAERSRRAQKNRDQARENRKRIEEVWRKDDES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.26
3 0.2
4 0.15
5 0.13
6 0.12
7 0.13
8 0.12
9 0.11
10 0.1
11 0.1
12 0.08
13 0.1
14 0.14
15 0.13
16 0.17
17 0.17
18 0.17
19 0.17
20 0.18
21 0.21
22 0.17
23 0.19
24 0.18
25 0.19
26 0.2
27 0.22
28 0.25
29 0.23
30 0.27
31 0.26
32 0.23
33 0.23
34 0.27
35 0.31
36 0.33
37 0.33
38 0.37
39 0.44
40 0.5
41 0.55
42 0.59
43 0.62
44 0.66
45 0.73
46 0.74
47 0.72
48 0.75
49 0.8
50 0.83
51 0.8
52 0.78
53 0.71
54 0.67
55 0.63
56 0.65
57 0.64
58 0.61
59 0.62