Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0V6M7

Protein Details
Accession A0A0L0V6M7    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
41-60GKMGKSAKFYKRPTRKEKMGBasic
124-147QDSIIKRKNLKSKVNKNSHKLPESHydrophilic
NLS Segment(s)
PositionSequence
172-174KKK
Subcellular Location(s) nucl 14, mito_nucl 12.333, mito 9.5, cyto_nucl 8.833
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSSNVFGRVQGLLHAYSTSTLPYFFIAALFSAHTSTHYSFGKMGKSAKFYKRPTRKEKMGISSNSNSLRAAIASSKFNRPEPTILPKHERPITTTSQGDKPYSLIQSDSNADTSQQDLDMEVDQDSIIKRKNLKSKVNKNSHKLPESDFKQIDYVDLYDRPDRRKSSLSNAKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.12
4 0.12
5 0.12
6 0.1
7 0.09
8 0.09
9 0.1
10 0.1
11 0.09
12 0.09
13 0.08
14 0.08
15 0.08
16 0.08
17 0.08
18 0.08
19 0.08
20 0.09
21 0.13
22 0.13
23 0.17
24 0.18
25 0.18
26 0.2
27 0.23
28 0.25
29 0.24
30 0.27
31 0.26
32 0.31
33 0.37
34 0.43
35 0.5
36 0.54
37 0.62
38 0.68
39 0.75
40 0.78
41 0.8
42 0.79
43 0.78
44 0.78
45 0.76
46 0.73
47 0.66
48 0.63
49 0.56
50 0.53
51 0.46
52 0.39
53 0.31
54 0.23
55 0.2
56 0.14
57 0.13
58 0.1
59 0.1
60 0.14
61 0.16
62 0.2
63 0.21
64 0.23
65 0.25
66 0.25
67 0.26
68 0.25
69 0.32
70 0.32
71 0.33
72 0.38
73 0.37
74 0.4
75 0.41
76 0.38
77 0.32
78 0.33
79 0.33
80 0.31
81 0.31
82 0.28
83 0.29
84 0.31
85 0.28
86 0.24
87 0.21
88 0.2
89 0.19
90 0.17
91 0.13
92 0.12
93 0.14
94 0.15
95 0.14
96 0.13
97 0.12
98 0.12
99 0.11
100 0.11
101 0.1
102 0.08
103 0.07
104 0.06
105 0.08
106 0.08
107 0.08
108 0.07
109 0.07
110 0.06
111 0.07
112 0.08
113 0.1
114 0.12
115 0.15
116 0.2
117 0.27
118 0.37
119 0.45
120 0.55
121 0.63
122 0.71
123 0.79
124 0.84
125 0.86
126 0.83
127 0.84
128 0.83
129 0.76
130 0.68
131 0.62
132 0.61
133 0.57
134 0.6
135 0.5
136 0.43
137 0.41
138 0.38
139 0.34
140 0.26
141 0.23
142 0.17
143 0.18
144 0.21
145 0.25
146 0.3
147 0.33
148 0.39
149 0.41
150 0.44
151 0.5
152 0.51
153 0.56
154 0.63