Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0VR52

Protein Details
Accession A0A0L0VR52    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
18-39KTDNFKCLKDPKKTKPWCPSYYHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 13, E.R. 5, cyto 4, vacu 3
Family & Domain DBs
Amino Acid Sequences MKLTDCLIVVLIQVALVKTDNFKCLKDPKKTKPWCPSYYAADADYQGSPAYYTFEPVTTYNNKDPYCEFLRGCCKPDFKPNGSLNSEQFNKICTIVEHKPPTPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.07
4 0.07
5 0.11
6 0.13
7 0.18
8 0.19
9 0.2
10 0.25
11 0.34
12 0.42
13 0.49
14 0.57
15 0.61
16 0.71
17 0.78
18 0.82
19 0.83
20 0.83
21 0.76
22 0.72
23 0.67
24 0.61
25 0.57
26 0.49
27 0.39
28 0.31
29 0.27
30 0.23
31 0.18
32 0.13
33 0.09
34 0.07
35 0.07
36 0.06
37 0.08
38 0.07
39 0.08
40 0.08
41 0.08
42 0.1
43 0.1
44 0.14
45 0.15
46 0.19
47 0.21
48 0.27
49 0.27
50 0.27
51 0.27
52 0.29
53 0.31
54 0.3
55 0.27
56 0.26
57 0.35
58 0.36
59 0.39
60 0.38
61 0.37
62 0.37
63 0.47
64 0.49
65 0.44
66 0.52
67 0.52
68 0.55
69 0.56
70 0.56
71 0.48
72 0.47
73 0.46
74 0.39
75 0.34
76 0.29
77 0.26
78 0.23
79 0.22
80 0.17
81 0.22
82 0.26
83 0.36
84 0.41