Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C6HDN9

Protein Details
Accession C6HDN9    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
44-65IFACISSRRRRRRGLQPFRGTGHydrophilic
NLS Segment(s)
PositionSequence
52-55RRRR
Subcellular Location(s) plas 11, mito 7, nucl 2, extr 2, E.R. 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR020999  Chitin_synth_reg_RCR  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF12273  RCR  
Amino Acid Sequences MPLLRRYVCYERLGREYCRTTWRDWGRWVALAILVFGAFFIFFIFACISSRRRRRRGLQPFRGTGWAAQNTFWPQQQRYPPPPPNGPPPQYTPNSGYYGPKPTYYGGQPQQPPYPYPPPQEQGVELQQPQNVHRAGERVYSPPPGPPPAPVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.52
3 0.51
4 0.49
5 0.52
6 0.5
7 0.44
8 0.5
9 0.55
10 0.52
11 0.52
12 0.55
13 0.49
14 0.48
15 0.46
16 0.36
17 0.29
18 0.23
19 0.19
20 0.12
21 0.09
22 0.07
23 0.06
24 0.05
25 0.03
26 0.03
27 0.03
28 0.03
29 0.03
30 0.05
31 0.06
32 0.06
33 0.08
34 0.11
35 0.14
36 0.23
37 0.33
38 0.42
39 0.49
40 0.56
41 0.63
42 0.72
43 0.79
44 0.82
45 0.83
46 0.81
47 0.76
48 0.7
49 0.64
50 0.53
51 0.43
52 0.37
53 0.3
54 0.23
55 0.2
56 0.2
57 0.21
58 0.22
59 0.22
60 0.19
61 0.17
62 0.22
63 0.29
64 0.34
65 0.38
66 0.45
67 0.49
68 0.51
69 0.55
70 0.52
71 0.54
72 0.55
73 0.51
74 0.45
75 0.44
76 0.45
77 0.42
78 0.42
79 0.37
80 0.33
81 0.33
82 0.31
83 0.29
84 0.26
85 0.3
86 0.28
87 0.26
88 0.24
89 0.21
90 0.24
91 0.23
92 0.29
93 0.27
94 0.33
95 0.36
96 0.38
97 0.42
98 0.41
99 0.41
100 0.39
101 0.44
102 0.41
103 0.43
104 0.45
105 0.43
106 0.44
107 0.43
108 0.38
109 0.35
110 0.35
111 0.34
112 0.3
113 0.3
114 0.28
115 0.28
116 0.27
117 0.29
118 0.24
119 0.21
120 0.21
121 0.22
122 0.22
123 0.26
124 0.27
125 0.24
126 0.27
127 0.31
128 0.3
129 0.32
130 0.35
131 0.35
132 0.34