Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0VZM5

Protein Details
Accession A0A0L0VZM5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
175-194LPKAWPKRLPFPKQPNIQPAHydrophilic
NLS Segment(s)
PositionSequence
215-227GRYGGRHKGHKNR
Subcellular Location(s) extr 22, plas 2, E.R. 1, golg 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MCQASLIRILSILSLLVGLCFETVNANWDEATGYLHDYKPSDGWLSKNKPKRCSKDIQIAECAHNTRLSYPDVQLMALFTVNHADDRYHGCPYGTCCAFTQLPLVNDMEPNPGNSHCFFRYDLAGFPGMGTNPIADPQTGTYGYETSIDGTFHRGPVDKRTRQPNHDRNYPGFHLPKAWPKRLPFPKQPNIQPACAAKGQANMDPGQEGERREGGRYGGRHKGHKNRGGSSGGYAPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.05
4 0.05
5 0.05
6 0.05
7 0.05
8 0.05
9 0.07
10 0.07
11 0.11
12 0.12
13 0.12
14 0.12
15 0.12
16 0.12
17 0.1
18 0.12
19 0.08
20 0.11
21 0.13
22 0.14
23 0.16
24 0.16
25 0.18
26 0.17
27 0.18
28 0.2
29 0.19
30 0.23
31 0.31
32 0.39
33 0.46
34 0.54
35 0.59
36 0.64
37 0.73
38 0.77
39 0.74
40 0.75
41 0.74
42 0.76
43 0.77
44 0.72
45 0.68
46 0.62
47 0.56
48 0.5
49 0.44
50 0.34
51 0.28
52 0.24
53 0.18
54 0.18
55 0.18
56 0.18
57 0.17
58 0.19
59 0.18
60 0.17
61 0.16
62 0.14
63 0.12
64 0.1
65 0.09
66 0.05
67 0.07
68 0.07
69 0.07
70 0.07
71 0.07
72 0.08
73 0.14
74 0.16
75 0.16
76 0.16
77 0.16
78 0.17
79 0.2
80 0.26
81 0.2
82 0.19
83 0.18
84 0.21
85 0.21
86 0.2
87 0.2
88 0.16
89 0.15
90 0.16
91 0.16
92 0.13
93 0.13
94 0.13
95 0.13
96 0.11
97 0.11
98 0.11
99 0.11
100 0.12
101 0.13
102 0.16
103 0.13
104 0.15
105 0.15
106 0.15
107 0.16
108 0.15
109 0.15
110 0.13
111 0.13
112 0.11
113 0.1
114 0.1
115 0.08
116 0.07
117 0.06
118 0.05
119 0.05
120 0.06
121 0.06
122 0.05
123 0.06
124 0.06
125 0.09
126 0.08
127 0.09
128 0.09
129 0.09
130 0.09
131 0.1
132 0.09
133 0.08
134 0.08
135 0.08
136 0.08
137 0.13
138 0.13
139 0.13
140 0.14
141 0.15
142 0.16
143 0.26
144 0.36
145 0.37
146 0.43
147 0.53
148 0.59
149 0.64
150 0.74
151 0.73
152 0.71
153 0.73
154 0.71
155 0.64
156 0.64
157 0.59
158 0.54
159 0.48
160 0.4
161 0.37
162 0.36
163 0.42
164 0.43
165 0.47
166 0.46
167 0.47
168 0.57
169 0.63
170 0.68
171 0.69
172 0.71
173 0.75
174 0.77
175 0.8
176 0.8
177 0.74
178 0.67
179 0.61
180 0.53
181 0.48
182 0.4
183 0.35
184 0.26
185 0.28
186 0.28
187 0.26
188 0.26
189 0.23
190 0.22
191 0.22
192 0.2
193 0.19
194 0.19
195 0.18
196 0.19
197 0.23
198 0.24
199 0.25
200 0.27
201 0.26
202 0.3
203 0.34
204 0.36
205 0.41
206 0.45
207 0.51
208 0.59
209 0.67
210 0.7
211 0.73
212 0.74
213 0.69
214 0.7
215 0.66
216 0.57
217 0.51