Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0UV66

Protein Details
Accession A0A0L0UV66   
Localization Confidence Low
Confidence Score 5.4
NoLS Segment(s)
PositionSequenceProtein Nature
57-82NTNQHRKPNTNQHRKPNKDQHRNGSTHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 24, nucl 1, pero 1, golg 1
Family & Domain DBs
Amino Acid Sequences MKLAVFVVTLIASLSSLEEILAAPVYRGRHHPNGTGHRKPTTNQHRKPTTNQHRKPNTNQHRKPNTNQHRKPNKDQHRNGSTQKKPIDPRIAELTDGRFPSFAGATYAYTSPFDSSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.05
5 0.05
6 0.05
7 0.05
8 0.06
9 0.06
10 0.06
11 0.08
12 0.1
13 0.11
14 0.16
15 0.23
16 0.3
17 0.32
18 0.39
19 0.45
20 0.54
21 0.61
22 0.63
23 0.6
24 0.57
25 0.56
26 0.5
27 0.53
28 0.54
29 0.56
30 0.56
31 0.62
32 0.66
33 0.68
34 0.74
35 0.75
36 0.74
37 0.75
38 0.75
39 0.75
40 0.76
41 0.78
42 0.79
43 0.79
44 0.79
45 0.79
46 0.78
47 0.79
48 0.8
49 0.79
50 0.77
51 0.77
52 0.77
53 0.77
54 0.77
55 0.78
56 0.78
57 0.8
58 0.84
59 0.84
60 0.84
61 0.83
62 0.84
63 0.83
64 0.79
65 0.78
66 0.76
67 0.75
68 0.69
69 0.66
70 0.63
71 0.61
72 0.59
73 0.62
74 0.63
75 0.54
76 0.54
77 0.53
78 0.5
79 0.44
80 0.41
81 0.36
82 0.31
83 0.31
84 0.27
85 0.19
86 0.18
87 0.19
88 0.18
89 0.14
90 0.12
91 0.13
92 0.13
93 0.16
94 0.17
95 0.15
96 0.16
97 0.16