Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0VLQ7

Protein Details
Accession A0A0L0VLQ7   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
9-37HNNYARKRGKYTSSKRKKVQERASLQKFLHydrophilic
NLS Segment(s)
PositionSequence
15-26KRGKYTSSKRKK
Subcellular Location(s) nucl 14.5, mito_nucl 12.666, cyto_nucl 9.833, mito 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR046798  2OG-FeII_Oxy_6  
Pfam View protein in Pfam  
PF20515  2OG-FeII_Oxy_6  
Amino Acid Sequences MGSSCRTSHNNYARKRGKYTSSKRKKVQERASLQKFLIGLNNTTNSIKQLICWQRVKWDPVKLYPNIIFDKNDNPDRSPTPEEVASACKIVNDKFFLLYKGRSVVRDPQDKNSIIAVIEFTQWGKLSDEDKKDLEFVSTFLHGSKRFINSVSSSNQSWGGKMWAIGWRNQAVRGRLLENTSRNDLQSLSTTIKLQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.73
3 0.69
4 0.69
5 0.71
6 0.76
7 0.77
8 0.79
9 0.83
10 0.85
11 0.89
12 0.89
13 0.89
14 0.88
15 0.87
16 0.86
17 0.86
18 0.85
19 0.79
20 0.68
21 0.6
22 0.49
23 0.4
24 0.36
25 0.27
26 0.22
27 0.21
28 0.23
29 0.22
30 0.22
31 0.22
32 0.17
33 0.18
34 0.16
35 0.14
36 0.22
37 0.27
38 0.34
39 0.37
40 0.36
41 0.41
42 0.46
43 0.51
44 0.47
45 0.47
46 0.44
47 0.47
48 0.52
49 0.45
50 0.45
51 0.42
52 0.4
53 0.35
54 0.34
55 0.28
56 0.24
57 0.29
58 0.29
59 0.32
60 0.29
61 0.28
62 0.3
63 0.31
64 0.35
65 0.32
66 0.29
67 0.25
68 0.24
69 0.23
70 0.2
71 0.21
72 0.16
73 0.13
74 0.12
75 0.1
76 0.11
77 0.11
78 0.12
79 0.12
80 0.11
81 0.12
82 0.13
83 0.14
84 0.15
85 0.14
86 0.13
87 0.15
88 0.15
89 0.15
90 0.17
91 0.23
92 0.28
93 0.36
94 0.37
95 0.39
96 0.43
97 0.43
98 0.42
99 0.34
100 0.28
101 0.19
102 0.17
103 0.13
104 0.08
105 0.08
106 0.07
107 0.07
108 0.07
109 0.07
110 0.08
111 0.09
112 0.1
113 0.13
114 0.19
115 0.22
116 0.24
117 0.25
118 0.24
119 0.24
120 0.22
121 0.21
122 0.15
123 0.12
124 0.12
125 0.12
126 0.11
127 0.11
128 0.15
129 0.14
130 0.16
131 0.2
132 0.21
133 0.21
134 0.22
135 0.24
136 0.23
137 0.26
138 0.28
139 0.27
140 0.24
141 0.25
142 0.29
143 0.26
144 0.23
145 0.21
146 0.2
147 0.17
148 0.17
149 0.18
150 0.19
151 0.21
152 0.24
153 0.27
154 0.3
155 0.3
156 0.35
157 0.38
158 0.34
159 0.38
160 0.37
161 0.35
162 0.33
163 0.36
164 0.38
165 0.37
166 0.4
167 0.42
168 0.4
169 0.38
170 0.37
171 0.33
172 0.28
173 0.27
174 0.26
175 0.23