Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0W248

Protein Details
Accession A0A0L0W248    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
188-210HSHGSEPKKEKPNKDKTPTTSPSHydrophilic
NLS Segment(s)
PositionSequence
136-203KPKSAQEKEQDRLQKLDKQKKKVAELKSRLQKEEAKLKKLESEGKKEKNGSAHSHGSEPKKEKPNKDK
Subcellular Location(s) extr 18, mito 3, cyto 2, mito_nucl 2
Family & Domain DBs
Amino Acid Sequences MPFQKSQLLLLLLVSTTAMGYALDNFDSDTVIGEAGGPVDIPSRRLVFKRQDSPPGVGTKDTQIQPNPKPKLSGPPSTLSKPKDSNKPGKPASVPPSLDTPTGTKPSTAGTSTSPTPTDGGVDAPKSPGKSSQPEKPKSAQEKEQDRLQKLDKQKKKVAELKSRLQKEEAKLKKLESEGKKEKNGSAHSHGSEPKKEKPNKDKTPTTSPSPDKKPPSNGSSNNTFGNDPSKQPPTGNDPTKKPSAKDLTAPGKGKSAQVKPDADAPADSGPTPPPSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.07
3 0.05
4 0.05
5 0.05
6 0.04
7 0.05
8 0.06
9 0.08
10 0.08
11 0.08
12 0.09
13 0.09
14 0.09
15 0.08
16 0.08
17 0.07
18 0.07
19 0.07
20 0.06
21 0.06
22 0.06
23 0.06
24 0.05
25 0.04
26 0.09
27 0.09
28 0.1
29 0.14
30 0.16
31 0.19
32 0.22
33 0.3
34 0.36
35 0.45
36 0.53
37 0.55
38 0.62
39 0.62
40 0.63
41 0.6
42 0.54
43 0.46
44 0.38
45 0.34
46 0.29
47 0.32
48 0.3
49 0.3
50 0.31
51 0.37
52 0.44
53 0.52
54 0.53
55 0.48
56 0.5
57 0.47
58 0.52
59 0.5
60 0.51
61 0.44
62 0.46
63 0.49
64 0.5
65 0.55
66 0.47
67 0.47
68 0.47
69 0.49
70 0.53
71 0.56
72 0.62
73 0.62
74 0.69
75 0.65
76 0.62
77 0.59
78 0.56
79 0.54
80 0.51
81 0.45
82 0.37
83 0.39
84 0.36
85 0.33
86 0.27
87 0.24
88 0.2
89 0.23
90 0.22
91 0.17
92 0.16
93 0.18
94 0.19
95 0.17
96 0.14
97 0.13
98 0.15
99 0.17
100 0.18
101 0.16
102 0.15
103 0.14
104 0.13
105 0.12
106 0.09
107 0.09
108 0.09
109 0.1
110 0.09
111 0.1
112 0.11
113 0.11
114 0.11
115 0.14
116 0.16
117 0.22
118 0.26
119 0.32
120 0.41
121 0.44
122 0.48
123 0.48
124 0.52
125 0.53
126 0.53
127 0.52
128 0.51
129 0.54
130 0.53
131 0.55
132 0.52
133 0.46
134 0.45
135 0.41
136 0.39
137 0.42
138 0.5
139 0.51
140 0.53
141 0.57
142 0.59
143 0.64
144 0.65
145 0.65
146 0.65
147 0.64
148 0.66
149 0.69
150 0.67
151 0.6
152 0.56
153 0.51
154 0.46
155 0.5
156 0.47
157 0.43
158 0.41
159 0.41
160 0.41
161 0.4
162 0.44
163 0.39
164 0.44
165 0.48
166 0.52
167 0.56
168 0.54
169 0.53
170 0.5
171 0.5
172 0.45
173 0.42
174 0.41
175 0.38
176 0.4
177 0.43
178 0.41
179 0.44
180 0.43
181 0.45
182 0.5
183 0.56
184 0.62
185 0.67
186 0.74
187 0.77
188 0.81
189 0.81
190 0.77
191 0.81
192 0.75
193 0.71
194 0.69
195 0.66
196 0.66
197 0.65
198 0.67
199 0.65
200 0.67
201 0.69
202 0.66
203 0.66
204 0.67
205 0.65
206 0.63
207 0.61
208 0.58
209 0.51
210 0.46
211 0.39
212 0.31
213 0.31
214 0.28
215 0.25
216 0.28
217 0.3
218 0.3
219 0.31
220 0.33
221 0.36
222 0.44
223 0.49
224 0.5
225 0.52
226 0.56
227 0.65
228 0.64
229 0.57
230 0.57
231 0.56
232 0.53
233 0.53
234 0.57
235 0.56
236 0.61
237 0.62
238 0.53
239 0.5
240 0.48
241 0.47
242 0.47
243 0.45
244 0.44
245 0.49
246 0.5
247 0.46
248 0.52
249 0.49
250 0.41
251 0.36
252 0.31
253 0.26
254 0.25
255 0.23
256 0.18
257 0.18