Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0UP83

Protein Details
Accession A0A0L0UP83    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
110-133LSSNNIKQGKKKRKIVIRPGSFIFHydrophilic
NLS Segment(s)
PositionSequence
118-123GKKKRK
Subcellular Location(s) nucl 13.5, mito 9, cyto_nucl 9, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029063  SAM-dependent_MTases_sf  
Amino Acid Sequences MLANGWTLKDVTNTFLQNSKTPWTRAGEVITREQKHLSDRMIRFDPTLDQTIGFFAAVFIRASAEPKPVNPKETVVKPTTSIPLKPAPSRSQTVSDQTKKSSVQSPKSLLSSNNIKQGKKKRKIVIRPGSFIFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.27
3 0.28
4 0.27
5 0.29
6 0.33
7 0.33
8 0.33
9 0.36
10 0.36
11 0.37
12 0.36
13 0.38
14 0.36
15 0.34
16 0.41
17 0.45
18 0.41
19 0.4
20 0.38
21 0.35
22 0.34
23 0.34
24 0.3
25 0.31
26 0.31
27 0.36
28 0.38
29 0.37
30 0.33
31 0.3
32 0.29
33 0.23
34 0.24
35 0.18
36 0.15
37 0.15
38 0.15
39 0.14
40 0.11
41 0.07
42 0.05
43 0.05
44 0.05
45 0.05
46 0.04
47 0.05
48 0.06
49 0.07
50 0.08
51 0.11
52 0.1
53 0.12
54 0.21
55 0.21
56 0.23
57 0.22
58 0.24
59 0.26
60 0.3
61 0.33
62 0.26
63 0.26
64 0.25
65 0.26
66 0.29
67 0.26
68 0.22
69 0.21
70 0.25
71 0.27
72 0.29
73 0.32
74 0.32
75 0.34
76 0.37
77 0.36
78 0.35
79 0.35
80 0.4
81 0.44
82 0.45
83 0.43
84 0.43
85 0.44
86 0.4
87 0.4
88 0.41
89 0.4
90 0.42
91 0.46
92 0.48
93 0.48
94 0.5
95 0.49
96 0.41
97 0.39
98 0.41
99 0.38
100 0.43
101 0.44
102 0.43
103 0.5
104 0.6
105 0.65
106 0.66
107 0.72
108 0.72
109 0.78
110 0.87
111 0.9
112 0.9
113 0.87
114 0.82