Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0UZH8

Protein Details
Accession A0A0L0UZH8   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
294-319NQKFDRKNPGKPSRILRRYDRRSTDTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR042448  CCNB1IP1  
Gene Ontology GO:0000795  C:synaptonemal complex  
GO:0061630  F:ubiquitin protein ligase activity  
GO:0007131  P:reciprocal meiotic recombination  
Amino Acid Sequences MPGLQLSFAGTDIVCTSLNPTSDYKSSVLSGLPPSIILDIASRALKFWDYQQSVEASFQKSVAKQAQEVVSFFPDCGIQQLIKGPGHSHARVILFQQKAALLVQEKLNFKAQAKNEIKGSVDLLNDTSKICSSINLKPKISATNASILYTSVLVLVRRLRQTENALSLEKQRAMEASDLPTTARIGKRRPEESRQSFPGVGQGHFDLRGAPGNPNIPGRYVGSITPVKSVGHHSDYYGRPQDNIRRAGAGKPHREFMSRTGYGPNETDHRSRMFAEPAGFDGSELGRVSDLTGNQKFDRKNPGKPSRILRRYDRRSTDTLMEDDTRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.12
4 0.15
5 0.16
6 0.18
7 0.2
8 0.23
9 0.25
10 0.28
11 0.26
12 0.24
13 0.24
14 0.23
15 0.21
16 0.2
17 0.2
18 0.19
19 0.17
20 0.16
21 0.15
22 0.14
23 0.14
24 0.11
25 0.09
26 0.09
27 0.11
28 0.13
29 0.12
30 0.12
31 0.13
32 0.14
33 0.14
34 0.18
35 0.26
36 0.27
37 0.27
38 0.3
39 0.3
40 0.3
41 0.33
42 0.31
43 0.24
44 0.22
45 0.22
46 0.23
47 0.22
48 0.27
49 0.29
50 0.27
51 0.25
52 0.3
53 0.33
54 0.31
55 0.31
56 0.27
57 0.24
58 0.22
59 0.21
60 0.17
61 0.13
62 0.11
63 0.13
64 0.12
65 0.09
66 0.1
67 0.14
68 0.18
69 0.18
70 0.19
71 0.18
72 0.22
73 0.28
74 0.27
75 0.24
76 0.24
77 0.25
78 0.25
79 0.27
80 0.29
81 0.23
82 0.23
83 0.23
84 0.19
85 0.18
86 0.17
87 0.16
88 0.1
89 0.12
90 0.15
91 0.19
92 0.2
93 0.21
94 0.25
95 0.25
96 0.25
97 0.3
98 0.29
99 0.34
100 0.36
101 0.36
102 0.34
103 0.34
104 0.33
105 0.27
106 0.27
107 0.19
108 0.16
109 0.14
110 0.13
111 0.13
112 0.12
113 0.12
114 0.1
115 0.08
116 0.09
117 0.08
118 0.1
119 0.13
120 0.2
121 0.29
122 0.34
123 0.34
124 0.34
125 0.36
126 0.36
127 0.34
128 0.3
129 0.22
130 0.23
131 0.23
132 0.22
133 0.2
134 0.17
135 0.15
136 0.13
137 0.11
138 0.06
139 0.06
140 0.06
141 0.07
142 0.1
143 0.13
144 0.14
145 0.16
146 0.16
147 0.18
148 0.23
149 0.24
150 0.25
151 0.23
152 0.23
153 0.22
154 0.24
155 0.23
156 0.2
157 0.17
158 0.14
159 0.12
160 0.13
161 0.14
162 0.12
163 0.12
164 0.11
165 0.11
166 0.11
167 0.11
168 0.1
169 0.13
170 0.15
171 0.16
172 0.2
173 0.26
174 0.33
175 0.4
176 0.45
177 0.49
178 0.56
179 0.59
180 0.62
181 0.59
182 0.56
183 0.49
184 0.43
185 0.42
186 0.33
187 0.26
188 0.2
189 0.18
190 0.15
191 0.15
192 0.15
193 0.1
194 0.08
195 0.12
196 0.11
197 0.12
198 0.13
199 0.14
200 0.16
201 0.18
202 0.18
203 0.16
204 0.16
205 0.16
206 0.16
207 0.16
208 0.14
209 0.17
210 0.19
211 0.19
212 0.19
213 0.18
214 0.17
215 0.17
216 0.21
217 0.21
218 0.23
219 0.22
220 0.22
221 0.28
222 0.3
223 0.35
224 0.37
225 0.32
226 0.29
227 0.35
228 0.42
229 0.42
230 0.44
231 0.39
232 0.37
233 0.37
234 0.4
235 0.44
236 0.44
237 0.45
238 0.44
239 0.47
240 0.45
241 0.46
242 0.44
243 0.41
244 0.42
245 0.34
246 0.33
247 0.34
248 0.33
249 0.33
250 0.32
251 0.29
252 0.24
253 0.27
254 0.28
255 0.26
256 0.27
257 0.27
258 0.28
259 0.3
260 0.28
261 0.28
262 0.27
263 0.25
264 0.25
265 0.26
266 0.23
267 0.19
268 0.17
269 0.14
270 0.15
271 0.14
272 0.12
273 0.09
274 0.09
275 0.12
276 0.14
277 0.16
278 0.21
279 0.25
280 0.29
281 0.31
282 0.38
283 0.38
284 0.4
285 0.49
286 0.47
287 0.53
288 0.6
289 0.68
290 0.7
291 0.74
292 0.79
293 0.79
294 0.81
295 0.79
296 0.79
297 0.79
298 0.81
299 0.84
300 0.82
301 0.77
302 0.74
303 0.73
304 0.69
305 0.62
306 0.55
307 0.49
308 0.45