Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0VHP6

Protein Details
Accession A0A0L0VHP6    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
133-166YSKSGKIKPGTLRKWKENQKNEQKKKTKGKSRDKBasic
NLS Segment(s)
PositionSequence
137-166GKIKPGTLRKWKENQKNEQKKKTKGKSRDK
Subcellular Location(s) nucl 20, mito_nucl 14, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR008906  HATC_C_dom  
IPR012337  RNaseH-like_sf  
Gene Ontology GO:0046983  F:protein dimerization activity  
Pfam View protein in Pfam  
PF05699  Dimer_Tnp_hAT  
Amino Acid Sequences MWETNYKPSAQSPPSKEANPRPKPQTGVLAQLSGASEARAGNNLTNPLNMWLAGGLHLNEEGLPVNPPKWWIQQAQGGVTHGGLLHMALNVLSCPATTVDVKRAFSFGRDYVSFKRHRLSASSVTRGMTIAFYSKSGKIKPGTLRKWKENQKNEQKKKTKGKSRDK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.56
3 0.6
4 0.62
5 0.66
6 0.66
7 0.68
8 0.67
9 0.67
10 0.68
11 0.63
12 0.61
13 0.53
14 0.52
15 0.44
16 0.39
17 0.33
18 0.3
19 0.27
20 0.19
21 0.16
22 0.08
23 0.08
24 0.08
25 0.08
26 0.09
27 0.1
28 0.1
29 0.12
30 0.15
31 0.15
32 0.15
33 0.15
34 0.15
35 0.15
36 0.13
37 0.11
38 0.08
39 0.07
40 0.08
41 0.08
42 0.06
43 0.06
44 0.06
45 0.06
46 0.05
47 0.06
48 0.05
49 0.05
50 0.06
51 0.06
52 0.07
53 0.07
54 0.09
55 0.12
56 0.14
57 0.17
58 0.17
59 0.2
60 0.24
61 0.25
62 0.25
63 0.23
64 0.2
65 0.17
66 0.15
67 0.12
68 0.08
69 0.06
70 0.04
71 0.04
72 0.03
73 0.03
74 0.03
75 0.03
76 0.03
77 0.03
78 0.03
79 0.03
80 0.03
81 0.03
82 0.04
83 0.06
84 0.07
85 0.08
86 0.15
87 0.19
88 0.2
89 0.2
90 0.21
91 0.2
92 0.2
93 0.23
94 0.17
95 0.17
96 0.18
97 0.21
98 0.24
99 0.31
100 0.33
101 0.31
102 0.34
103 0.32
104 0.32
105 0.32
106 0.35
107 0.38
108 0.41
109 0.44
110 0.42
111 0.4
112 0.38
113 0.34
114 0.28
115 0.19
116 0.13
117 0.11
118 0.1
119 0.11
120 0.14
121 0.18
122 0.22
123 0.23
124 0.28
125 0.28
126 0.35
127 0.43
128 0.51
129 0.57
130 0.63
131 0.7
132 0.72
133 0.8
134 0.83
135 0.85
136 0.84
137 0.85
138 0.86
139 0.9
140 0.92
141 0.92
142 0.92
143 0.91
144 0.93
145 0.92
146 0.92