Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0VGY6

Protein Details
Accession A0A0L0VGY6    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
9-29GAPTCDYSHHRRPPKKFVAPVHydrophilic
NLS Segment(s)
PositionSequence
76-80PKSRR
Subcellular Location(s) nucl 24.5, cyto_nucl 15
Family & Domain DBs
Amino Acid Sequences MDSPTCPIGAPTCDYSHHRRPPKKFVAPVIPPPTTSRSTRRQGIVFPTTAVPQEIKDLKALPPTPKLPPAPLSPPPKSRRRNRIVFDLNNIEQQLKDLECDAPPRQNNSSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.37
3 0.44
4 0.5
5 0.57
6 0.63
7 0.69
8 0.76
9 0.82
10 0.82
11 0.78
12 0.75
13 0.75
14 0.71
15 0.73
16 0.69
17 0.59
18 0.51
19 0.48
20 0.45
21 0.39
22 0.37
23 0.34
24 0.36
25 0.41
26 0.45
27 0.46
28 0.43
29 0.42
30 0.45
31 0.42
32 0.34
33 0.29
34 0.25
35 0.22
36 0.2
37 0.18
38 0.11
39 0.08
40 0.12
41 0.12
42 0.12
43 0.12
44 0.13
45 0.13
46 0.18
47 0.2
48 0.19
49 0.22
50 0.24
51 0.26
52 0.29
53 0.29
54 0.27
55 0.28
56 0.29
57 0.31
58 0.36
59 0.41
60 0.41
61 0.49
62 0.53
63 0.6
64 0.65
65 0.7
66 0.73
67 0.74
68 0.79
69 0.75
70 0.8
71 0.79
72 0.73
73 0.7
74 0.66
75 0.59
76 0.52
77 0.48
78 0.37
79 0.28
80 0.26
81 0.22
82 0.15
83 0.14
84 0.13
85 0.14
86 0.15
87 0.21
88 0.23
89 0.29
90 0.33
91 0.38