Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0VC27

Protein Details
Accession A0A0L0VC27    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
17-42YRDRSPGATRRTRKERRWRVTNPAAAHydrophilic
NLS Segment(s)
PositionSequence
28-31TRKE
Subcellular Location(s) nucl 14.5, cyto_nucl 9.833, mito 6.5, cyto_mito 5.833, cyto 4
Family & Domain DBs
Amino Acid Sequences MSKLYISVMTSPTLGFYRDRSPGATRRTRKERRWRVTNPAAAQAFSTTVIPRTRFDYSERAALQKRITDGTKYKPGFASNRTLTVSESKGSESDSDHRLYSRIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.13
3 0.15
4 0.19
5 0.23
6 0.24
7 0.25
8 0.3
9 0.36
10 0.43
11 0.5
12 0.51
13 0.57
14 0.67
15 0.74
16 0.78
17 0.82
18 0.85
19 0.84
20 0.88
21 0.84
22 0.83
23 0.82
24 0.79
25 0.69
26 0.65
27 0.55
28 0.45
29 0.39
30 0.3
31 0.22
32 0.15
33 0.14
34 0.07
35 0.1
36 0.12
37 0.13
38 0.13
39 0.17
40 0.18
41 0.18
42 0.22
43 0.24
44 0.24
45 0.28
46 0.28
47 0.28
48 0.28
49 0.3
50 0.28
51 0.24
52 0.24
53 0.21
54 0.22
55 0.23
56 0.26
57 0.3
58 0.38
59 0.36
60 0.37
61 0.36
62 0.39
63 0.39
64 0.38
65 0.41
66 0.33
67 0.37
68 0.36
69 0.35
70 0.32
71 0.32
72 0.3
73 0.23
74 0.21
75 0.19
76 0.18
77 0.19
78 0.18
79 0.18
80 0.2
81 0.23
82 0.24
83 0.24
84 0.24