Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0VP93

Protein Details
Accession A0A0L0VP93    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
28-54VSGRSTRQKDDRRTRPRWAQLNRVHPIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 11.5, cyto 6.5, mito 3
Family & Domain DBs
Amino Acid Sequences MSLDARPGENGPHIDSPHLHQSQQVTTVSGRSTRQKDDRRTRPRWAQLNRVHPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.24
3 0.25
4 0.3
5 0.29
6 0.25
7 0.24
8 0.26
9 0.25
10 0.27
11 0.24
12 0.16
13 0.15
14 0.16
15 0.15
16 0.14
17 0.15
18 0.19
19 0.23
20 0.28
21 0.38
22 0.45
23 0.56
24 0.64
25 0.73
26 0.76
27 0.79
28 0.82
29 0.83
30 0.84
31 0.83
32 0.8
33 0.79
34 0.78