Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0UL31

Protein Details
Accession A0A0L0UL31   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
83-108FEDKYFKLAKWKPKWINKAIRLTREMHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 5, pero 3
Family & Domain DBs
Amino Acid Sequences VLQPFYKITLQVSTPGAARISDIVVFINQITGHLSLAISDQRDGYPPALRNACRGGLQLTNKYYTLTNCSPLYRVAMVLHPLFEDKYFKLAKWKPKWINKAIRLTREM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.19
4 0.15
5 0.15
6 0.12
7 0.11
8 0.1
9 0.1
10 0.09
11 0.08
12 0.09
13 0.08
14 0.08
15 0.07
16 0.07
17 0.08
18 0.08
19 0.08
20 0.08
21 0.07
22 0.06
23 0.08
24 0.09
25 0.08
26 0.08
27 0.09
28 0.08
29 0.1
30 0.11
31 0.11
32 0.14
33 0.15
34 0.19
35 0.22
36 0.22
37 0.23
38 0.24
39 0.24
40 0.2
41 0.19
42 0.17
43 0.17
44 0.19
45 0.21
46 0.21
47 0.21
48 0.21
49 0.21
50 0.2
51 0.17
52 0.21
53 0.18
54 0.21
55 0.21
56 0.21
57 0.21
58 0.21
59 0.23
60 0.16
61 0.16
62 0.13
63 0.14
64 0.16
65 0.15
66 0.15
67 0.13
68 0.13
69 0.13
70 0.13
71 0.14
72 0.12
73 0.17
74 0.18
75 0.19
76 0.28
77 0.34
78 0.44
79 0.5
80 0.6
81 0.64
82 0.73
83 0.82
84 0.82
85 0.86
86 0.85
87 0.87
88 0.84