Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0VQD9

Protein Details
Accession A0A0L0VQD9    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
112-137EVNINPLPRRRRYRHSRDRSRASPSSHydrophilic
NLS Segment(s)
PositionSequence
121-125RRRYR
Subcellular Location(s) nucl 17, mito 4, cyto 4, cyto_mito 4
Family & Domain DBs
Amino Acid Sequences MRLWKVSLTWLLMHHFTFCSTELARQIVVSTGRLSRPACDHCRSTSELIVTPVDQYCQSLKRCRVHRCNLFQTGLRFECESCPQWAGIIKWRRCEGHKRFHRDCSTCGNVGEVNINPLPRRRRYRHSRDRSRASPSSSTGSNSVEMDRRPPDRPFYTFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.2
3 0.18
4 0.18
5 0.17
6 0.18
7 0.17
8 0.19
9 0.2
10 0.21
11 0.2
12 0.18
13 0.17
14 0.17
15 0.17
16 0.15
17 0.14
18 0.16
19 0.16
20 0.21
21 0.21
22 0.2
23 0.25
24 0.31
25 0.36
26 0.37
27 0.39
28 0.37
29 0.41
30 0.42
31 0.39
32 0.34
33 0.3
34 0.27
35 0.26
36 0.24
37 0.2
38 0.18
39 0.15
40 0.13
41 0.11
42 0.11
43 0.11
44 0.16
45 0.2
46 0.26
47 0.33
48 0.39
49 0.47
50 0.56
51 0.62
52 0.67
53 0.72
54 0.73
55 0.72
56 0.69
57 0.63
58 0.56
59 0.49
60 0.44
61 0.36
62 0.29
63 0.22
64 0.18
65 0.18
66 0.19
67 0.18
68 0.14
69 0.14
70 0.13
71 0.13
72 0.15
73 0.14
74 0.19
75 0.27
76 0.28
77 0.31
78 0.34
79 0.35
80 0.37
81 0.46
82 0.46
83 0.48
84 0.54
85 0.6
86 0.62
87 0.69
88 0.73
89 0.66
90 0.61
91 0.59
92 0.55
93 0.47
94 0.42
95 0.35
96 0.27
97 0.24
98 0.24
99 0.15
100 0.14
101 0.14
102 0.15
103 0.15
104 0.21
105 0.27
106 0.33
107 0.43
108 0.46
109 0.56
110 0.66
111 0.76
112 0.81
113 0.86
114 0.88
115 0.89
116 0.92
117 0.87
118 0.85
119 0.79
120 0.74
121 0.67
122 0.59
123 0.53
124 0.45
125 0.42
126 0.36
127 0.32
128 0.28
129 0.24
130 0.24
131 0.24
132 0.23
133 0.26
134 0.3
135 0.32
136 0.35
137 0.38
138 0.43
139 0.45