Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D9P9P5

Protein Details
Accession A0A0D9P9P5    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
23-42GMRKNGKQWHEQKKAFRPSKBasic
72-122EAMRKEKTEKIREKRAKKEEKERYEKMAETMHRKRVERLKRKEKRNKLINSBasic
NLS Segment(s)
PositionSequence
21-118PLGMRKNGKQWHEQKKAFRPSKGLTTFEKRAKERAAMAQMKAKEKEMKEEKEAMRKEKTEKIREKRAKKEEKERYEKMAETMHRKRVERLKRKEKRNK
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MSDDEAPTLVPAEGQERASKPLGMRKNGKQWHEQKKAFRPSKGLTTFEKRAKERAAMAQMKAKEKEMKEEKEAMRKEKTEKIREKRAKKEEKERYEKMAETMHRKRVERLKRKEKRNKLINS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.17
3 0.18
4 0.22
5 0.23
6 0.25
7 0.24
8 0.31
9 0.37
10 0.4
11 0.46
12 0.49
13 0.58
14 0.62
15 0.64
16 0.65
17 0.67
18 0.71
19 0.74
20 0.72
21 0.71
22 0.74
23 0.81
24 0.77
25 0.7
26 0.65
27 0.58
28 0.62
29 0.57
30 0.5
31 0.45
32 0.46
33 0.5
34 0.49
35 0.53
36 0.44
37 0.45
38 0.43
39 0.4
40 0.35
41 0.34
42 0.37
43 0.33
44 0.32
45 0.32
46 0.33
47 0.34
48 0.32
49 0.29
50 0.26
51 0.24
52 0.32
53 0.35
54 0.35
55 0.35
56 0.42
57 0.42
58 0.46
59 0.49
60 0.44
61 0.41
62 0.41
63 0.42
64 0.43
65 0.49
66 0.51
67 0.58
68 0.61
69 0.68
70 0.75
71 0.8
72 0.82
73 0.84
74 0.84
75 0.83
76 0.85
77 0.85
78 0.86
79 0.86
80 0.79
81 0.75
82 0.69
83 0.62
84 0.54
85 0.5
86 0.45
87 0.46
88 0.5
89 0.51
90 0.54
91 0.54
92 0.59
93 0.62
94 0.68
95 0.69
96 0.73
97 0.76
98 0.79
99 0.89
100 0.92
101 0.93
102 0.93