Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D9PCK7

Protein Details
Accession A0A0D9PCK7    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
144-168AEAPVDKKVKKKAKKIKLSFDEDEGHydrophilic
NLS Segment(s)
PositionSequence
113-119RKRKVGK
147-160PVDKKVKKKAKKIK
Subcellular Location(s) nucl 16, cyto_nucl 11.5, mito 6, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027911  DUF4604  
Pfam View protein in Pfam  
PF15377  DUF4604  
Amino Acid Sequences MPEKITSKNLSYNSSLPPFLARLHAQSAGATGPDPLLAAQKRSAKKRSACEEAEDAPLVVDEHGNAVDLQIEKDGTVKETETKSDKDETRGAESDEKAVRRDTDAAASSIGARKRKVGKVIGERASHGSGNDGKDKQDDKLGGAEAPVDKKVKKKAKKIKLSFDEDEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.38
3 0.31
4 0.3
5 0.27
6 0.24
7 0.25
8 0.21
9 0.2
10 0.23
11 0.24
12 0.22
13 0.21
14 0.2
15 0.16
16 0.14
17 0.11
18 0.08
19 0.07
20 0.06
21 0.06
22 0.06
23 0.12
24 0.12
25 0.14
26 0.19
27 0.27
28 0.33
29 0.4
30 0.46
31 0.48
32 0.54
33 0.61
34 0.63
35 0.63
36 0.59
37 0.55
38 0.53
39 0.47
40 0.43
41 0.34
42 0.26
43 0.18
44 0.17
45 0.13
46 0.09
47 0.06
48 0.04
49 0.04
50 0.04
51 0.05
52 0.05
53 0.04
54 0.06
55 0.06
56 0.07
57 0.07
58 0.07
59 0.06
60 0.07
61 0.08
62 0.07
63 0.07
64 0.07
65 0.1
66 0.11
67 0.14
68 0.16
69 0.17
70 0.18
71 0.23
72 0.23
73 0.23
74 0.26
75 0.25
76 0.27
77 0.26
78 0.26
79 0.24
80 0.23
81 0.24
82 0.24
83 0.23
84 0.19
85 0.2
86 0.19
87 0.17
88 0.19
89 0.15
90 0.16
91 0.16
92 0.15
93 0.14
94 0.14
95 0.13
96 0.15
97 0.18
98 0.17
99 0.17
100 0.22
101 0.29
102 0.33
103 0.38
104 0.4
105 0.45
106 0.52
107 0.6
108 0.61
109 0.55
110 0.52
111 0.5
112 0.46
113 0.38
114 0.28
115 0.23
116 0.21
117 0.23
118 0.27
119 0.25
120 0.24
121 0.29
122 0.31
123 0.28
124 0.3
125 0.28
126 0.23
127 0.26
128 0.26
129 0.21
130 0.19
131 0.21
132 0.17
133 0.18
134 0.2
135 0.2
136 0.21
137 0.27
138 0.38
139 0.45
140 0.52
141 0.61
142 0.69
143 0.77
144 0.86
145 0.89
146 0.9
147 0.89
148 0.88