Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D9P208

Protein Details
Accession A0A0D9P208   
Localization Confidence High
Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
7-28RPSFTSFWRKGKQKLRGKPSAAHydrophilic
NLS Segment(s)
PositionSequence
17-22GKQKLR
Subcellular Location(s) nucl 23, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
CDD cd14688  bZIP_YAP  
Amino Acid Sequences MSEDASRPSFTSFWRKGKQKLRGKPSAAATPEGAAAAADPSSADAAEQPKPDKDKAQLRRAQVRRAQIQHRQRKANYIKQLEIDVSELRDLVSLTEKETAAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.58
3 0.64
4 0.73
5 0.79
6 0.79
7 0.81
8 0.81
9 0.81
10 0.78
11 0.74
12 0.69
13 0.66
14 0.58
15 0.5
16 0.41
17 0.32
18 0.28
19 0.22
20 0.17
21 0.09
22 0.07
23 0.05
24 0.04
25 0.03
26 0.03
27 0.03
28 0.04
29 0.04
30 0.03
31 0.05
32 0.07
33 0.1
34 0.12
35 0.12
36 0.15
37 0.18
38 0.19
39 0.2
40 0.24
41 0.31
42 0.38
43 0.47
44 0.49
45 0.52
46 0.61
47 0.62
48 0.64
49 0.59
50 0.58
51 0.56
52 0.57
53 0.59
54 0.58
55 0.65
56 0.67
57 0.7
58 0.71
59 0.65
60 0.69
61 0.7
62 0.7
63 0.7
64 0.65
65 0.6
66 0.54
67 0.55
68 0.45
69 0.37
70 0.3
71 0.22
72 0.17
73 0.15
74 0.13
75 0.11
76 0.11
77 0.1
78 0.09
79 0.14
80 0.13
81 0.15
82 0.19