Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D9PE65

Protein Details
Accession A0A0D9PE65    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
450-508ADAPASAKKEKKDKKEKKDKKEKKEKKRKRDEEEAPPADDDAEKKKKKKKRKSKAADEEBasic
NLS Segment(s)
PositionSequence
456-504AKKEKKDKKEKKDKKEKKEKKRKRDEEEAPPADDDAEKKKKKKKRKSKA
Subcellular Location(s) cyto 20.5, cyto_mito 11.333, nucl 4.5, mito_nucl 3.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR045056  Nop56/Nop58  
IPR012974  NOP58/56_N  
IPR042239  Nop_C  
IPR002687  Nop_dom  
IPR036070  Nop_dom_sf  
IPR012976  NOSIC  
Gene Ontology GO:0031428  C:box C/D RNP complex  
GO:0005730  C:nucleolus  
GO:0032040  C:small-subunit processome  
GO:0030515  F:snoRNA binding  
GO:0042254  P:ribosome biogenesis  
Pfam View protein in Pfam  
PF01798  Nop  
PF08156  NOP5NT  
PROSITE View protein in PROSITE  
PS51358  NOP  
Amino Acid Sequences MSHIDYALYESPVGYALFQVVHQSDAVGLKLKETQAAVNDLAKFGKMVKLTNFSPFRGHVEALENINLVSEGIVSEYLKSVLELNLPKAGKKAKVVLGVSEKNLAGAIKSEFPGLECETADTSDIVGDVIRGLRLHADKLLKDLKPGDIEKAGLGMGHAYSRAKVKFSVTKNDNHIIQASATIDFQDKGVNQFFMRVREWYGWHFPELVKIVSDNLTYAKLVLAIGDKKTLNDEKLHDLAAILGEDGEKAQAIIDAAKVSMGLDIAAADLEIIAGFAEAVVKQAENRKTTSAYLEKKMGHVAPNLQALIGTPVAARLISHAGSLTNLSKYPASTLQILGAEKALFRALKTKSNTPKYGLIYHSSFIGKAGVRNKGRISRYLANKCSMASRIDNFSEEPSTRFGEALRQQVEDRLEFYASGKKPAKNADVMKSVMSVLGDGAGKDSDDEMADAPASAKKEKKDKKEKKDKKEKKEKKRKRDEEEAPPADDDAEKKKKKKKRKSKAADEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.08
3 0.09
4 0.09
5 0.09
6 0.13
7 0.12
8 0.13
9 0.13
10 0.13
11 0.13
12 0.14
13 0.15
14 0.17
15 0.16
16 0.16
17 0.21
18 0.21
19 0.22
20 0.22
21 0.24
22 0.21
23 0.26
24 0.26
25 0.26
26 0.26
27 0.25
28 0.24
29 0.21
30 0.18
31 0.15
32 0.19
33 0.16
34 0.19
35 0.23
36 0.29
37 0.31
38 0.4
39 0.42
40 0.38
41 0.4
42 0.38
43 0.39
44 0.36
45 0.35
46 0.28
47 0.3
48 0.32
49 0.3
50 0.29
51 0.23
52 0.19
53 0.19
54 0.16
55 0.11
56 0.08
57 0.05
58 0.04
59 0.05
60 0.06
61 0.06
62 0.07
63 0.08
64 0.08
65 0.08
66 0.08
67 0.09
68 0.1
69 0.15
70 0.17
71 0.18
72 0.24
73 0.25
74 0.25
75 0.28
76 0.32
77 0.3
78 0.32
79 0.37
80 0.36
81 0.43
82 0.43
83 0.44
84 0.47
85 0.46
86 0.43
87 0.39
88 0.33
89 0.26
90 0.26
91 0.2
92 0.12
93 0.12
94 0.12
95 0.12
96 0.13
97 0.13
98 0.12
99 0.13
100 0.16
101 0.16
102 0.15
103 0.13
104 0.14
105 0.14
106 0.15
107 0.15
108 0.11
109 0.09
110 0.08
111 0.08
112 0.06
113 0.05
114 0.05
115 0.05
116 0.05
117 0.06
118 0.06
119 0.06
120 0.11
121 0.12
122 0.13
123 0.17
124 0.2
125 0.2
126 0.25
127 0.32
128 0.28
129 0.29
130 0.3
131 0.28
132 0.3
133 0.31
134 0.29
135 0.23
136 0.23
137 0.2
138 0.19
139 0.16
140 0.1
141 0.09
142 0.07
143 0.05
144 0.05
145 0.06
146 0.06
147 0.07
148 0.12
149 0.14
150 0.14
151 0.15
152 0.2
153 0.27
154 0.31
155 0.4
156 0.38
157 0.43
158 0.48
159 0.5
160 0.46
161 0.39
162 0.36
163 0.27
164 0.23
165 0.19
166 0.14
167 0.11
168 0.1
169 0.09
170 0.09
171 0.08
172 0.08
173 0.09
174 0.09
175 0.11
176 0.13
177 0.14
178 0.13
179 0.18
180 0.2
181 0.21
182 0.22
183 0.2
184 0.2
185 0.22
186 0.24
187 0.22
188 0.26
189 0.23
190 0.23
191 0.23
192 0.21
193 0.23
194 0.23
195 0.19
196 0.13
197 0.12
198 0.13
199 0.12
200 0.12
201 0.09
202 0.08
203 0.08
204 0.08
205 0.08
206 0.07
207 0.06
208 0.06
209 0.06
210 0.08
211 0.09
212 0.09
213 0.12
214 0.12
215 0.12
216 0.16
217 0.17
218 0.16
219 0.18
220 0.19
221 0.21
222 0.22
223 0.22
224 0.18
225 0.16
226 0.14
227 0.12
228 0.09
229 0.05
230 0.04
231 0.03
232 0.03
233 0.03
234 0.03
235 0.03
236 0.02
237 0.03
238 0.03
239 0.03
240 0.04
241 0.04
242 0.04
243 0.04
244 0.04
245 0.04
246 0.04
247 0.04
248 0.03
249 0.03
250 0.03
251 0.03
252 0.03
253 0.03
254 0.03
255 0.02
256 0.02
257 0.02
258 0.02
259 0.02
260 0.02
261 0.02
262 0.02
263 0.02
264 0.02
265 0.02
266 0.03
267 0.04
268 0.04
269 0.05
270 0.12
271 0.17
272 0.18
273 0.2
274 0.21
275 0.23
276 0.24
277 0.28
278 0.29
279 0.29
280 0.3
281 0.33
282 0.32
283 0.31
284 0.33
285 0.3
286 0.24
287 0.21
288 0.21
289 0.2
290 0.21
291 0.2
292 0.17
293 0.15
294 0.13
295 0.13
296 0.1
297 0.07
298 0.05
299 0.06
300 0.06
301 0.06
302 0.05
303 0.05
304 0.07
305 0.07
306 0.07
307 0.07
308 0.07
309 0.08
310 0.1
311 0.1
312 0.09
313 0.09
314 0.1
315 0.1
316 0.1
317 0.13
318 0.14
319 0.15
320 0.15
321 0.15
322 0.16
323 0.18
324 0.18
325 0.15
326 0.14
327 0.12
328 0.1
329 0.1
330 0.1
331 0.08
332 0.08
333 0.15
334 0.17
335 0.24
336 0.28
337 0.37
338 0.45
339 0.53
340 0.55
341 0.52
342 0.56
343 0.52
344 0.53
345 0.47
346 0.42
347 0.36
348 0.33
349 0.32
350 0.26
351 0.22
352 0.17
353 0.18
354 0.14
355 0.17
356 0.22
357 0.28
358 0.29
359 0.33
360 0.37
361 0.42
362 0.43
363 0.44
364 0.47
365 0.46
366 0.55
367 0.61
368 0.6
369 0.55
370 0.53
371 0.48
372 0.44
373 0.37
374 0.31
375 0.25
376 0.25
377 0.27
378 0.27
379 0.28
380 0.26
381 0.26
382 0.26
383 0.23
384 0.22
385 0.2
386 0.21
387 0.2
388 0.19
389 0.17
390 0.22
391 0.26
392 0.32
393 0.31
394 0.3
395 0.3
396 0.35
397 0.37
398 0.29
399 0.26
400 0.2
401 0.18
402 0.17
403 0.18
404 0.23
405 0.21
406 0.29
407 0.33
408 0.34
409 0.38
410 0.45
411 0.48
412 0.47
413 0.52
414 0.5
415 0.49
416 0.48
417 0.44
418 0.38
419 0.33
420 0.26
421 0.2
422 0.13
423 0.08
424 0.1
425 0.09
426 0.08
427 0.09
428 0.09
429 0.08
430 0.09
431 0.09
432 0.08
433 0.08
434 0.09
435 0.08
436 0.09
437 0.09
438 0.08
439 0.09
440 0.11
441 0.13
442 0.17
443 0.21
444 0.27
445 0.38
446 0.47
447 0.57
448 0.66
449 0.74
450 0.81
451 0.88
452 0.93
453 0.93
454 0.96
455 0.95
456 0.95
457 0.96
458 0.95
459 0.95
460 0.96
461 0.96
462 0.96
463 0.97
464 0.96
465 0.94
466 0.94
467 0.92
468 0.91
469 0.91
470 0.84
471 0.75
472 0.65
473 0.56
474 0.46
475 0.38
476 0.3
477 0.29
478 0.35
479 0.41
480 0.49
481 0.58
482 0.67
483 0.77
484 0.85
485 0.87
486 0.88
487 0.91
488 0.94