Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D9NH96

Protein Details
Accession A0A0D9NH96    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
43-68QRVQKNRSSRFSKRRRNFLKKAHDLHHydrophilic
NLS Segment(s)
PositionSequence
54-58SKRRR
Subcellular Location(s) nucl 20, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
GO:0006351  P:DNA-templated transcription  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00319  SRF-TF  
PROSITE View protein in PROSITE  
PS50066  MADS_BOX_2  
Amino Acid Sequences MTCNQCFARFSPFVGNELAQIYSDHIACNNSKDCRPVNIGDMQRVQKNRSSRFSKRRRNFLKKAHDLHIDCEVDVYLCVRSKRSNKIWQYSSDFTPPSQRELV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.31
3 0.24
4 0.24
5 0.22
6 0.13
7 0.12
8 0.12
9 0.11
10 0.11
11 0.1
12 0.1
13 0.12
14 0.12
15 0.16
16 0.19
17 0.21
18 0.22
19 0.26
20 0.27
21 0.29
22 0.32
23 0.29
24 0.27
25 0.31
26 0.31
27 0.31
28 0.33
29 0.32
30 0.32
31 0.32
32 0.31
33 0.28
34 0.33
35 0.35
36 0.39
37 0.45
38 0.5
39 0.59
40 0.68
41 0.74
42 0.75
43 0.8
44 0.83
45 0.85
46 0.85
47 0.84
48 0.84
49 0.82
50 0.8
51 0.74
52 0.71
53 0.62
54 0.55
55 0.53
56 0.42
57 0.33
58 0.28
59 0.23
60 0.15
61 0.14
62 0.13
63 0.08
64 0.11
65 0.12
66 0.14
67 0.21
68 0.28
69 0.38
70 0.46
71 0.54
72 0.59
73 0.68
74 0.7
75 0.69
76 0.71
77 0.66
78 0.61
79 0.57
80 0.49
81 0.41
82 0.47
83 0.41