Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C6HAW2

Protein Details
Accession C6HAW2    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MVSRQRKRKNKNKHNEYYPVYKGHydrophilic
NLS Segment(s)
PositionSequence
6-11RKRKNK
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR037056  RNase_H1_N_sf  
Amino Acid Sequences MVSRQRKRKNKNKHNEYYPVYKGRVNQPTIFSSSGDAHPRVTGCNADFRGCVTIEEAREFMKIRGVTEPKRREQARQLHYRTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.89
3 0.84
4 0.8
5 0.76
6 0.7
7 0.61
8 0.52
9 0.48
10 0.48
11 0.5
12 0.46
13 0.42
14 0.4
15 0.4
16 0.42
17 0.38
18 0.29
19 0.24
20 0.22
21 0.22
22 0.21
23 0.19
24 0.16
25 0.16
26 0.16
27 0.15
28 0.13
29 0.12
30 0.09
31 0.15
32 0.15
33 0.16
34 0.15
35 0.16
36 0.17
37 0.15
38 0.15
39 0.11
40 0.13
41 0.13
42 0.14
43 0.14
44 0.13
45 0.14
46 0.15
47 0.13
48 0.17
49 0.16
50 0.16
51 0.24
52 0.3
53 0.37
54 0.46
55 0.53
56 0.53
57 0.62
58 0.63
59 0.62
60 0.65
61 0.68
62 0.68
63 0.71