Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D9PBN4

Protein Details
Accession A0A0D9PBN4    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
155-181SSLQAKASRKHPKEYRKARERHPSPEYHydrophilic
NLS Segment(s)
PositionSequence
160-176KASRKHPKEYRKARERH
Subcellular Location(s) nucl 16, cyto 6, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019371  KxDL_dom  
Gene Ontology GO:0005768  C:endosome  
Pfam View protein in Pfam  
PF10241  KxDL  
Amino Acid Sequences MSGPFPTVSYAMPMAVPGKGNQYPTYTHYSMSPPECDDDMSSASGVPSYGNSGYTGSASYMGSNDYDSANSASGIDFQEYMQERFANSFNPIPLDRSMAVQAQTSGKLNAKHRELMDLQKQAQARLAKTRERFQDGMRDAREVRGDLEWTQKKVSSLQAKASRKHPKEYRKARERHPSPEY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.14
4 0.11
5 0.17
6 0.2
7 0.23
8 0.23
9 0.25
10 0.26
11 0.29
12 0.37
13 0.3
14 0.28
15 0.28
16 0.3
17 0.33
18 0.33
19 0.31
20 0.24
21 0.26
22 0.26
23 0.25
24 0.22
25 0.19
26 0.17
27 0.15
28 0.14
29 0.11
30 0.11
31 0.1
32 0.09
33 0.07
34 0.05
35 0.07
36 0.08
37 0.08
38 0.09
39 0.09
40 0.1
41 0.1
42 0.1
43 0.08
44 0.09
45 0.08
46 0.08
47 0.07
48 0.07
49 0.07
50 0.07
51 0.07
52 0.06
53 0.07
54 0.07
55 0.08
56 0.08
57 0.07
58 0.07
59 0.06
60 0.08
61 0.08
62 0.07
63 0.07
64 0.06
65 0.11
66 0.13
67 0.13
68 0.13
69 0.12
70 0.12
71 0.13
72 0.14
73 0.1
74 0.11
75 0.11
76 0.1
77 0.12
78 0.13
79 0.13
80 0.13
81 0.14
82 0.13
83 0.13
84 0.14
85 0.13
86 0.13
87 0.11
88 0.12
89 0.11
90 0.11
91 0.11
92 0.11
93 0.13
94 0.17
95 0.22
96 0.27
97 0.29
98 0.32
99 0.31
100 0.34
101 0.33
102 0.35
103 0.38
104 0.36
105 0.34
106 0.34
107 0.35
108 0.3
109 0.34
110 0.3
111 0.25
112 0.29
113 0.32
114 0.36
115 0.39
116 0.46
117 0.46
118 0.5
119 0.49
120 0.43
121 0.49
122 0.45
123 0.49
124 0.43
125 0.41
126 0.35
127 0.36
128 0.36
129 0.26
130 0.24
131 0.19
132 0.2
133 0.18
134 0.28
135 0.3
136 0.3
137 0.31
138 0.31
139 0.31
140 0.31
141 0.39
142 0.38
143 0.37
144 0.44
145 0.52
146 0.57
147 0.6
148 0.67
149 0.69
150 0.64
151 0.71
152 0.71
153 0.72
154 0.77
155 0.83
156 0.85
157 0.84
158 0.88
159 0.87
160 0.89
161 0.85