Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D9PB71

Protein Details
Accession A0A0D9PB71    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
47-81AVNARTARRKIRDQKKARSKARPKPLSSRERRKLGBasic
NLS Segment(s)
PositionSequence
50-79ARTARRKIRDQKKARSKARPKPLSSRERRK
Subcellular Location(s) nucl 16.5, cyto_nucl 12.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016848  RNase_P/MRP_Rpp29-subunit  
IPR036980  RNase_P/MRP_Rpp29_sf  
IPR023538  RNP1  
IPR023534  Rof/RNase_P-like  
IPR002730  Rpp29/RNP1  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0000172  C:ribonuclease MRP complex  
GO:0030677  C:ribonuclease P complex  
GO:0004519  F:endonuclease activity  
GO:0033204  F:ribonuclease P RNA binding  
GO:0001682  P:tRNA 5'-leader removal  
Pfam View protein in Pfam  
PF01868  RNase_P-MRP_p29  
Amino Acid Sequences MAATTPQQLTKDLLARAHSPDSVNRIYNEKILHRALHLRPSSPPPAAVNARTARRKIRDQKKARSKARPKPLSSRERRKLGLYDIPKDGQKYSIYEPLYELWQGYAREILGRDIFRRGPEAAAKLASAELHGALTEVVRSRCPGRVGLKGIIVRDRKFVIEIITEKKGIKIIPKEGTTFRIEVRPETTQTATDSKPFVFEVLGDQLMLRSADRANRKFKQHFLPDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.32
3 0.34
4 0.34
5 0.31
6 0.28
7 0.29
8 0.33
9 0.33
10 0.34
11 0.31
12 0.32
13 0.32
14 0.34
15 0.34
16 0.31
17 0.32
18 0.33
19 0.32
20 0.31
21 0.38
22 0.37
23 0.42
24 0.4
25 0.36
26 0.38
27 0.43
28 0.44
29 0.37
30 0.36
31 0.29
32 0.34
33 0.36
34 0.33
35 0.34
36 0.35
37 0.41
38 0.44
39 0.45
40 0.47
41 0.49
42 0.58
43 0.61
44 0.67
45 0.7
46 0.75
47 0.83
48 0.86
49 0.9
50 0.89
51 0.89
52 0.89
53 0.88
54 0.89
55 0.87
56 0.81
57 0.81
58 0.82
59 0.82
60 0.82
61 0.83
62 0.8
63 0.77
64 0.74
65 0.67
66 0.6
67 0.55
68 0.53
69 0.46
70 0.42
71 0.38
72 0.38
73 0.36
74 0.34
75 0.29
76 0.23
77 0.19
78 0.18
79 0.18
80 0.23
81 0.22
82 0.21
83 0.22
84 0.2
85 0.2
86 0.17
87 0.13
88 0.08
89 0.11
90 0.1
91 0.1
92 0.09
93 0.08
94 0.09
95 0.1
96 0.1
97 0.09
98 0.1
99 0.11
100 0.13
101 0.14
102 0.13
103 0.15
104 0.14
105 0.13
106 0.14
107 0.15
108 0.14
109 0.13
110 0.13
111 0.11
112 0.1
113 0.09
114 0.07
115 0.05
116 0.04
117 0.04
118 0.04
119 0.04
120 0.04
121 0.04
122 0.04
123 0.07
124 0.07
125 0.08
126 0.09
127 0.11
128 0.14
129 0.16
130 0.2
131 0.21
132 0.27
133 0.31
134 0.31
135 0.34
136 0.32
137 0.32
138 0.34
139 0.35
140 0.3
141 0.28
142 0.27
143 0.24
144 0.23
145 0.22
146 0.18
147 0.18
148 0.2
149 0.22
150 0.23
151 0.24
152 0.23
153 0.23
154 0.23
155 0.2
156 0.24
157 0.25
158 0.3
159 0.35
160 0.37
161 0.4
162 0.39
163 0.42
164 0.38
165 0.34
166 0.28
167 0.28
168 0.27
169 0.26
170 0.29
171 0.28
172 0.28
173 0.3
174 0.3
175 0.26
176 0.28
177 0.3
178 0.27
179 0.26
180 0.26
181 0.22
182 0.23
183 0.21
184 0.19
185 0.14
186 0.13
187 0.14
188 0.16
189 0.16
190 0.14
191 0.13
192 0.13
193 0.14
194 0.14
195 0.11
196 0.09
197 0.11
198 0.18
199 0.28
200 0.35
201 0.43
202 0.49
203 0.59
204 0.63
205 0.68
206 0.72