Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D9NN07

Protein Details
Accession A0A0D9NN07    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
44-69NPNPDLKPKPDQKPKPDQKPNPESSTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto_nucl 9.833, mito 6, cyto 4.5, cyto_pero 4.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR036908  RlpA-like_sf  
CDD cd22191  DPBB_RlpA_EXP_N-like  
Amino Acid Sequences MASPACKMPTYEPSTNPNPDPNPIPDTIPSPNSNPSPNQNPNPNPNPDLKPKPDQKPKPDQKPNPESSTALASGTNMGGTIYKYELDQCLKDFETQGACELKANYPNSNPNKLSLVALPSVEFDKAGKNKVCGKVISMTYKGITQQAVVADRNAGAKPSIDMCTDVWEKLGVAVSVGRLEGGIDWSIADA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.56
3 0.53
4 0.51
5 0.45
6 0.44
7 0.45
8 0.42
9 0.4
10 0.36
11 0.36
12 0.3
13 0.32
14 0.32
15 0.32
16 0.29
17 0.28
18 0.32
19 0.32
20 0.34
21 0.33
22 0.36
23 0.41
24 0.46
25 0.5
26 0.54
27 0.57
28 0.62
29 0.65
30 0.63
31 0.56
32 0.55
33 0.54
34 0.53
35 0.55
36 0.52
37 0.55
38 0.58
39 0.66
40 0.71
41 0.74
42 0.74
43 0.78
44 0.83
45 0.85
46 0.87
47 0.85
48 0.85
49 0.85
50 0.82
51 0.76
52 0.68
53 0.57
54 0.48
55 0.43
56 0.33
57 0.23
58 0.17
59 0.12
60 0.11
61 0.1
62 0.08
63 0.05
64 0.04
65 0.05
66 0.05
67 0.05
68 0.05
69 0.06
70 0.06
71 0.07
72 0.09
73 0.1
74 0.11
75 0.11
76 0.13
77 0.13
78 0.14
79 0.13
80 0.12
81 0.12
82 0.11
83 0.13
84 0.11
85 0.1
86 0.11
87 0.12
88 0.12
89 0.16
90 0.18
91 0.17
92 0.18
93 0.27
94 0.3
95 0.35
96 0.34
97 0.3
98 0.31
99 0.3
100 0.29
101 0.22
102 0.19
103 0.14
104 0.14
105 0.12
106 0.11
107 0.11
108 0.1
109 0.09
110 0.07
111 0.13
112 0.15
113 0.21
114 0.21
115 0.24
116 0.32
117 0.37
118 0.4
119 0.34
120 0.34
121 0.34
122 0.36
123 0.38
124 0.32
125 0.28
126 0.25
127 0.26
128 0.25
129 0.21
130 0.17
131 0.12
132 0.13
133 0.14
134 0.17
135 0.16
136 0.16
137 0.14
138 0.15
139 0.16
140 0.14
141 0.13
142 0.1
143 0.1
144 0.11
145 0.14
146 0.15
147 0.14
148 0.16
149 0.15
150 0.21
151 0.22
152 0.21
153 0.18
154 0.17
155 0.16
156 0.16
157 0.17
158 0.11
159 0.1
160 0.11
161 0.11
162 0.11
163 0.11
164 0.09
165 0.07
166 0.07
167 0.07
168 0.09
169 0.09
170 0.08