Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D9PCL7

Protein Details
Accession A0A0D9PCL7    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
6-27PSKPGPGTKPVRKSRQAPKSENHydrophilic
NLS Segment(s)
PositionSequence
14-19KPVRKS
Subcellular Location(s) mito 12, cyto 8, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR042831  YmL28  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Amino Acid Sequences MARQAPSKPGPGTKPVRKSRQAPKSENFQRIKTLRQNMFSPAPPPLRMARQRYLRHWTIHRAWQLFRRQQHESMGKERQRMHAGMYNACEELRKTVGPDGRGEGYLYRVAMEKKGVWGTDAVPIEYARFQTDSPAKEPWNHDWKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.69
3 0.74
4 0.75
5 0.8
6 0.81
7 0.82
8 0.82
9 0.79
10 0.75
11 0.76
12 0.77
13 0.78
14 0.71
15 0.63
16 0.63
17 0.57
18 0.6
19 0.58
20 0.59
21 0.54
22 0.54
23 0.54
24 0.5
25 0.51
26 0.45
27 0.37
28 0.34
29 0.32
30 0.28
31 0.29
32 0.27
33 0.31
34 0.37
35 0.42
36 0.43
37 0.5
38 0.54
39 0.57
40 0.61
41 0.57
42 0.55
43 0.52
44 0.52
45 0.47
46 0.49
47 0.48
48 0.43
49 0.41
50 0.43
51 0.48
52 0.46
53 0.46
54 0.45
55 0.43
56 0.43
57 0.48
58 0.46
59 0.41
60 0.41
61 0.45
62 0.42
63 0.44
64 0.44
65 0.41
66 0.38
67 0.35
68 0.33
69 0.29
70 0.28
71 0.26
72 0.25
73 0.22
74 0.19
75 0.19
76 0.16
77 0.11
78 0.12
79 0.12
80 0.11
81 0.11
82 0.16
83 0.19
84 0.2
85 0.21
86 0.21
87 0.21
88 0.21
89 0.2
90 0.16
91 0.15
92 0.15
93 0.14
94 0.11
95 0.12
96 0.13
97 0.14
98 0.16
99 0.14
100 0.17
101 0.19
102 0.19
103 0.17
104 0.17
105 0.17
106 0.21
107 0.22
108 0.18
109 0.17
110 0.17
111 0.17
112 0.18
113 0.18
114 0.13
115 0.13
116 0.13
117 0.2
118 0.27
119 0.29
120 0.31
121 0.35
122 0.35
123 0.4
124 0.46
125 0.47