Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D9NJC7

Protein Details
Accession A0A0D9NJC7   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
30-57MVKPLSFKGDKRPKKRKRAADADRDDGEBasic
NLS Segment(s)
PositionSequence
35-48SFKGDKRPKKRKRA
238-254FKPKLKASKEEKALSKI
Subcellular Location(s) nucl 16.5, cyto_nucl 11.5, cyto 5.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008999  Actin-crosslinking  
IPR010414  FRG1  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF06229  FRG1  
Amino Acid Sequences MELAASRSRVRRSLLTDANRAFPDCPTRRMVKPLSFKGDKRPKKRKRAADADRDDGEAGPSRVQKLNNDDDAAADDDSWVSADVATDVVGPVMIVLPTEKPSALACDPNGKVFAMPIENIVDGNPTSAEPHDVRMVWVANKVSGTDNFRFKGHHGRYLACDKIGFLSATSEAISPLECFNVIATADTPSTFQLQTLRETFVTIKPSTSSKSTAPAEIRGDEDKITFNTTMRIRMQARFKPKLKASKEEKALSKISRRELEEAVGRRLDENEVKVLKRARREGDYHERLLDLKVKNRHDKFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.58
3 0.62
4 0.6
5 0.61
6 0.55
7 0.5
8 0.41
9 0.36
10 0.39
11 0.35
12 0.37
13 0.37
14 0.41
15 0.43
16 0.51
17 0.55
18 0.53
19 0.59
20 0.63
21 0.67
22 0.68
23 0.67
24 0.69
25 0.73
26 0.74
27 0.75
28 0.78
29 0.79
30 0.84
31 0.92
32 0.91
33 0.91
34 0.92
35 0.91
36 0.91
37 0.88
38 0.83
39 0.74
40 0.64
41 0.54
42 0.43
43 0.34
44 0.27
45 0.21
46 0.18
47 0.19
48 0.21
49 0.24
50 0.25
51 0.28
52 0.32
53 0.38
54 0.37
55 0.37
56 0.33
57 0.3
58 0.31
59 0.28
60 0.2
61 0.13
62 0.1
63 0.08
64 0.08
65 0.08
66 0.06
67 0.05
68 0.04
69 0.05
70 0.05
71 0.05
72 0.05
73 0.05
74 0.04
75 0.04
76 0.04
77 0.03
78 0.03
79 0.03
80 0.03
81 0.03
82 0.04
83 0.05
84 0.07
85 0.08
86 0.08
87 0.08
88 0.09
89 0.13
90 0.14
91 0.15
92 0.14
93 0.21
94 0.22
95 0.22
96 0.22
97 0.18
98 0.17
99 0.14
100 0.15
101 0.09
102 0.09
103 0.09
104 0.09
105 0.09
106 0.09
107 0.09
108 0.08
109 0.07
110 0.07
111 0.06
112 0.05
113 0.06
114 0.06
115 0.09
116 0.09
117 0.1
118 0.12
119 0.11
120 0.12
121 0.13
122 0.13
123 0.11
124 0.13
125 0.12
126 0.11
127 0.11
128 0.11
129 0.11
130 0.12
131 0.17
132 0.17
133 0.2
134 0.21
135 0.21
136 0.21
137 0.21
138 0.3
139 0.27
140 0.3
141 0.28
142 0.29
143 0.32
144 0.36
145 0.35
146 0.25
147 0.23
148 0.17
149 0.16
150 0.16
151 0.12
152 0.07
153 0.08
154 0.07
155 0.08
156 0.08
157 0.07
158 0.06
159 0.06
160 0.06
161 0.06
162 0.06
163 0.06
164 0.05
165 0.05
166 0.05
167 0.06
168 0.06
169 0.05
170 0.06
171 0.07
172 0.07
173 0.07
174 0.08
175 0.08
176 0.1
177 0.09
178 0.09
179 0.12
180 0.14
181 0.17
182 0.18
183 0.2
184 0.17
185 0.19
186 0.2
187 0.19
188 0.23
189 0.2
190 0.19
191 0.18
192 0.2
193 0.21
194 0.22
195 0.22
196 0.18
197 0.25
198 0.26
199 0.29
200 0.29
201 0.31
202 0.31
203 0.29
204 0.3
205 0.25
206 0.24
207 0.2
208 0.19
209 0.17
210 0.15
211 0.17
212 0.15
213 0.14
214 0.19
215 0.2
216 0.24
217 0.23
218 0.3
219 0.29
220 0.35
221 0.43
222 0.45
223 0.53
224 0.57
225 0.6
226 0.62
227 0.66
228 0.7
229 0.67
230 0.7
231 0.69
232 0.69
233 0.73
234 0.71
235 0.68
236 0.63
237 0.63
238 0.59
239 0.59
240 0.55
241 0.55
242 0.54
243 0.53
244 0.52
245 0.48
246 0.47
247 0.47
248 0.44
249 0.41
250 0.36
251 0.33
252 0.3
253 0.3
254 0.3
255 0.26
256 0.25
257 0.28
258 0.31
259 0.31
260 0.36
261 0.42
262 0.42
263 0.46
264 0.52
265 0.51
266 0.54
267 0.58
268 0.62
269 0.66
270 0.67
271 0.62
272 0.55
273 0.49
274 0.43
275 0.42
276 0.41
277 0.35
278 0.36
279 0.42
280 0.49
281 0.59