Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D9NNB9

Protein Details
Accession A0A0D9NNB9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
382-411TDEGLNRRRNPKLSQRTKRQHPEDSRDASNHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 20, golg 3, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR029058  AB_hydrolase  
IPR000073  AB_hydrolase_1  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF12697  Abhydrolase_6  
Amino Acid Sequences MFLFQFPGLNQGFTRPQGAARAVSPIYFVLPIVLIFSFYYLRRSPPKSGKVEPGNERSASSGRTKKTSGDGSSASLTPSEGISPDESNASNKTLPPAAEPGLQILHDCEVPKIDIVAVHGLGANPDYAWVWLPKNNPPNRRGYPNKPFNWLQELLPAKLPKPCRVLAFNYDSRWFWDAPQQKLSSISDTLLDSLRNDREQNKAIDRPLIFIGHSFGGNVIEQAIVSASRHCSPHLSISASTIGVVFLGTPHRGSPAAAWGGIIASLMPSGLAPEDRLLRALEKHSDSLADRLRDFSGWLFSESVPVVCAFEQLVTDYSSRLPLLGTFVPSRTLVVDEDSACIDGHHKISLHTDHLKINKYYGADDPSFKLIYPEIQRMVEGTDEGLNRRRNPKLSQRTKRQHPEDSRDASNG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.23
3 0.24
4 0.28
5 0.31
6 0.28
7 0.24
8 0.28
9 0.26
10 0.25
11 0.24
12 0.19
13 0.18
14 0.15
15 0.14
16 0.09
17 0.09
18 0.09
19 0.1
20 0.09
21 0.09
22 0.08
23 0.1
24 0.12
25 0.12
26 0.17
27 0.17
28 0.23
29 0.31
30 0.36
31 0.44
32 0.52
33 0.61
34 0.63
35 0.68
36 0.72
37 0.72
38 0.75
39 0.74
40 0.71
41 0.66
42 0.59
43 0.54
44 0.47
45 0.41
46 0.35
47 0.36
48 0.36
49 0.35
50 0.39
51 0.4
52 0.39
53 0.44
54 0.49
55 0.43
56 0.41
57 0.39
58 0.37
59 0.38
60 0.35
61 0.28
62 0.21
63 0.18
64 0.13
65 0.12
66 0.1
67 0.07
68 0.09
69 0.11
70 0.11
71 0.12
72 0.13
73 0.14
74 0.15
75 0.17
76 0.18
77 0.17
78 0.17
79 0.2
80 0.2
81 0.2
82 0.2
83 0.22
84 0.21
85 0.22
86 0.22
87 0.21
88 0.19
89 0.18
90 0.16
91 0.13
92 0.12
93 0.11
94 0.11
95 0.1
96 0.1
97 0.11
98 0.11
99 0.1
100 0.09
101 0.08
102 0.1
103 0.11
104 0.1
105 0.09
106 0.1
107 0.09
108 0.09
109 0.09
110 0.07
111 0.05
112 0.05
113 0.05
114 0.05
115 0.06
116 0.08
117 0.1
118 0.13
119 0.16
120 0.23
121 0.32
122 0.39
123 0.45
124 0.47
125 0.54
126 0.55
127 0.62
128 0.63
129 0.63
130 0.67
131 0.7
132 0.69
133 0.66
134 0.63
135 0.58
136 0.56
137 0.48
138 0.37
139 0.34
140 0.34
141 0.29
142 0.3
143 0.28
144 0.22
145 0.26
146 0.28
147 0.27
148 0.29
149 0.3
150 0.29
151 0.32
152 0.36
153 0.37
154 0.41
155 0.38
156 0.36
157 0.35
158 0.32
159 0.31
160 0.29
161 0.23
162 0.17
163 0.22
164 0.27
165 0.28
166 0.33
167 0.31
168 0.3
169 0.32
170 0.32
171 0.26
172 0.2
173 0.17
174 0.13
175 0.12
176 0.13
177 0.11
178 0.1
179 0.08
180 0.11
181 0.12
182 0.12
183 0.14
184 0.15
185 0.19
186 0.22
187 0.25
188 0.26
189 0.28
190 0.27
191 0.3
192 0.28
193 0.26
194 0.23
195 0.2
196 0.16
197 0.13
198 0.14
199 0.1
200 0.09
201 0.07
202 0.06
203 0.07
204 0.07
205 0.06
206 0.05
207 0.04
208 0.04
209 0.04
210 0.04
211 0.03
212 0.04
213 0.05
214 0.06
215 0.09
216 0.09
217 0.1
218 0.12
219 0.13
220 0.18
221 0.19
222 0.2
223 0.18
224 0.2
225 0.2
226 0.18
227 0.17
228 0.12
229 0.09
230 0.06
231 0.06
232 0.04
233 0.04
234 0.06
235 0.06
236 0.06
237 0.07
238 0.08
239 0.08
240 0.09
241 0.09
242 0.12
243 0.13
244 0.12
245 0.12
246 0.11
247 0.1
248 0.1
249 0.09
250 0.04
251 0.03
252 0.03
253 0.03
254 0.03
255 0.02
256 0.03
257 0.03
258 0.04
259 0.04
260 0.06
261 0.09
262 0.09
263 0.1
264 0.11
265 0.12
266 0.14
267 0.16
268 0.2
269 0.2
270 0.21
271 0.2
272 0.22
273 0.21
274 0.25
275 0.27
276 0.25
277 0.23
278 0.24
279 0.24
280 0.22
281 0.22
282 0.17
283 0.17
284 0.15
285 0.16
286 0.16
287 0.15
288 0.17
289 0.17
290 0.16
291 0.12
292 0.11
293 0.1
294 0.08
295 0.09
296 0.07
297 0.07
298 0.07
299 0.08
300 0.09
301 0.1
302 0.1
303 0.1
304 0.11
305 0.12
306 0.12
307 0.1
308 0.09
309 0.08
310 0.13
311 0.14
312 0.16
313 0.16
314 0.17
315 0.19
316 0.19
317 0.19
318 0.15
319 0.15
320 0.12
321 0.13
322 0.16
323 0.14
324 0.15
325 0.15
326 0.15
327 0.13
328 0.13
329 0.12
330 0.12
331 0.13
332 0.14
333 0.14
334 0.15
335 0.21
336 0.24
337 0.28
338 0.3
339 0.32
340 0.35
341 0.4
342 0.45
343 0.4
344 0.4
345 0.37
346 0.33
347 0.32
348 0.31
349 0.32
350 0.28
351 0.3
352 0.3
353 0.31
354 0.3
355 0.27
356 0.25
357 0.2
358 0.25
359 0.27
360 0.31
361 0.3
362 0.3
363 0.3
364 0.29
365 0.3
366 0.23
367 0.18
368 0.14
369 0.15
370 0.16
371 0.19
372 0.26
373 0.31
374 0.36
375 0.44
376 0.49
377 0.51
378 0.59
379 0.66
380 0.7
381 0.75
382 0.8
383 0.84
384 0.87
385 0.92
386 0.94
387 0.92
388 0.91
389 0.9
390 0.89
391 0.87
392 0.83