Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C6H4A3

Protein Details
Accession C6H4A3    Localization Confidence High Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
44-74TKPPQTRFINSPRQRRRRRRRPTHDKSRRAPBasic
NLS Segment(s)
PositionSequence
55-74PRQRRRRRRRPTHDKSRRAP
Subcellular Location(s) nucl 26
Family & Domain DBs
Amino Acid Sequences MSFAAAPAVEIRENDLIPDTTRTSFPSALTSTDKAPHHLGCSRTKPPQTRFINSPRQRRRRRRRPTHDKSRRAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.15
4 0.15
5 0.18
6 0.17
7 0.16
8 0.17
9 0.18
10 0.2
11 0.2
12 0.19
13 0.2
14 0.19
15 0.2
16 0.22
17 0.21
18 0.19
19 0.24
20 0.23
21 0.22
22 0.23
23 0.21
24 0.21
25 0.23
26 0.25
27 0.26
28 0.32
29 0.34
30 0.38
31 0.44
32 0.49
33 0.5
34 0.57
35 0.57
36 0.56
37 0.58
38 0.6
39 0.65
40 0.65
41 0.72
42 0.73
43 0.77
44 0.83
45 0.88
46 0.91
47 0.91
48 0.95
49 0.95
50 0.96
51 0.96
52 0.96
53 0.97
54 0.96