Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D9NSK5

Protein Details
Accession A0A0D9NSK5   
Localization Confidence High
Confidence Score 17.4
NoLS Segment(s)
PositionSequenceProtein Nature
31-53ATPEEPLKRRLRPRKERIECIEAHydrophilic
70-95GQRSSSIKLKPKPRRTPNRDHRSVNAHydrophilic
NLS Segment(s)
PositionSequence
38-45KRRLRPRK
76-91IKLKPKPRRTPNRDHR
Subcellular Location(s) nucl 20, cyto_nucl 13, cyto 4
Family & Domain DBs
Amino Acid Sequences MVTAPMPADPAELKNVSMYGFGAIPNLEASATPEEPLKRRLRPRKERIECIEAPDADVFIVNVRQRSNGGQRSSSIKLKPKPRRTPNRDHRSVNAKPGSKFLPIEILDSEKKAASSDT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.15
4 0.14
5 0.13
6 0.09
7 0.09
8 0.08
9 0.08
10 0.08
11 0.08
12 0.07
13 0.07
14 0.06
15 0.05
16 0.08
17 0.12
18 0.12
19 0.12
20 0.15
21 0.17
22 0.19
23 0.27
24 0.3
25 0.33
26 0.43
27 0.54
28 0.62
29 0.71
30 0.78
31 0.82
32 0.84
33 0.85
34 0.81
35 0.78
36 0.68
37 0.62
38 0.56
39 0.44
40 0.38
41 0.29
42 0.23
43 0.14
44 0.14
45 0.08
46 0.04
47 0.07
48 0.07
49 0.08
50 0.08
51 0.09
52 0.1
53 0.14
54 0.22
55 0.26
56 0.27
57 0.27
58 0.28
59 0.33
60 0.36
61 0.38
62 0.35
63 0.37
64 0.42
65 0.51
66 0.6
67 0.66
68 0.73
69 0.79
70 0.85
71 0.86
72 0.9
73 0.91
74 0.91
75 0.88
76 0.82
77 0.78
78 0.75
79 0.7
80 0.68
81 0.65
82 0.59
83 0.52
84 0.52
85 0.48
86 0.43
87 0.4
88 0.31
89 0.32
90 0.27
91 0.29
92 0.26
93 0.28
94 0.26
95 0.27
96 0.27
97 0.2
98 0.19