Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D9NHH4

Protein Details
Accession A0A0D9NHH4    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
22-48ASVYLRRLRHLRKRVKRVQRCTPYRLVHydrophilic
NLS Segment(s)
PositionSequence
33-35RKR
Subcellular Location(s) cysk 14, nucl 5, cyto 4, pero 3, mito_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036915  Cyclin-like_sf  
IPR013922  Cyclin_PHO80-like  
Gene Ontology GO:0019901  F:protein kinase binding  
GO:0000079  P:regulation of cyclin-dependent protein serine/threonine kinase activity  
Pfam View protein in Pfam  
PF08613  Cyclin  
CDD cd20557  CYCLIN_ScPCL1-like  
Amino Acid Sequences MEVYIPYLVETFRLEALELLHASVYLRRLRHLRKRVKRVQRCTPYRLVLAALAVAHKYLRDNSYTNVDWGRGFHLSKPEMDKAEMAMLKLLGWKLRISDEEQKAVEFSDFDHLKRPIRENRISLTREDAIIGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.12
4 0.14
5 0.12
6 0.11
7 0.1
8 0.1
9 0.1
10 0.11
11 0.14
12 0.15
13 0.16
14 0.2
15 0.28
16 0.38
17 0.48
18 0.56
19 0.63
20 0.7
21 0.8
22 0.86
23 0.9
24 0.91
25 0.89
26 0.9
27 0.89
28 0.85
29 0.81
30 0.77
31 0.68
32 0.59
33 0.51
34 0.4
35 0.3
36 0.23
37 0.17
38 0.11
39 0.08
40 0.07
41 0.06
42 0.05
43 0.05
44 0.06
45 0.07
46 0.08
47 0.11
48 0.12
49 0.13
50 0.19
51 0.19
52 0.19
53 0.18
54 0.17
55 0.15
56 0.14
57 0.14
58 0.11
59 0.11
60 0.12
61 0.17
62 0.17
63 0.19
64 0.23
65 0.23
66 0.23
67 0.23
68 0.21
69 0.17
70 0.2
71 0.19
72 0.14
73 0.12
74 0.11
75 0.1
76 0.12
77 0.12
78 0.09
79 0.09
80 0.1
81 0.1
82 0.13
83 0.14
84 0.18
85 0.27
86 0.3
87 0.33
88 0.33
89 0.32
90 0.3
91 0.29
92 0.24
93 0.14
94 0.12
95 0.17
96 0.17
97 0.17
98 0.24
99 0.26
100 0.32
101 0.37
102 0.44
103 0.44
104 0.52
105 0.59
106 0.56
107 0.61
108 0.64
109 0.61
110 0.55
111 0.52
112 0.45
113 0.38